Recombinant Mouse C-X-C chemokine receptor type 4 (Cxcr4)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms and Activation

CXCR4 activation by CXCL12 involves:

  • Ligand binding: The CXCL12 N-terminus inserts into the orthosteric pocket, displacing E288 and Y255 to trigger TM6 outward movement .

  • G-protein coupling: Conformational changes enable Gαi binding, initiating downstream pathways (e.g., MAPK, PI3K-Akt) .

  • Oligomerization: Cryo-EM structures reveal trimeric/tetrameric assemblies that modulate allosteric signaling .

Key Mutations Affecting Function:

MutationImpactSource
P191AReduces HIV-1 co-receptor activity by 88%
E288AAbolishes CXCL12 binding and Gαi coupling
W94RDisrupts chemokine binding (↓90% affinity)

HIV Inhibition

  • CRISPR-engineered CXCR4(P191A) mutations reduce HIV-1 entry by 80–90% in vitro .

  • AMD3100 (Plerixafor), a CXCR4 antagonist, blocks viral entry via electrostatic interactions with E288 .

Cancer Biology

  • High CXCR4 expression correlates with poor prognosis in 15+ cancer types (TCGA pan-cancer data) .

  • Intracellular CXCR4 (not surface-bound) drives paclitaxel resistance by repressing DR5 pro-apoptotic signals .

Stem Cell Mobilization

  • CXCR4 antagonists enhance hematopoietic stem cell harvests by disrupting CXCL12-mediated bone marrow retention .

Preclinical Models

  • Humanized CXCR4 knock-in mice: Retain normal development but enable evaluation of anti-CXCR4 therapeutics (e.g., AMD3100 mobilizes leukocytes 3-fold) .

  • Xenograft models: CXCR4+ tumors show 50% faster metastasis rates, reversible with REGN7663 (anti-CXCR4 antibody) .

Challenges in Targeting CXCR4

ChallengeMechanismSolution
Drug resistanceIntracellular CXCR4 bypasses ligand-blockade Proteolysis-targeting chimeras (PROTACs)
Conformational plasticityOligomerization alters antagonist efficacy Structure-guided antibody design
ToxicityDisruption of hematopoiesis or immune homeostasis Tissue-specific delivery systems

Future Directions

  • Structural optimization: Cryo-EM-guided engineering of antibodies (e.g., REGN7663) for enhanced steric inhibition .

  • Combination therapies: Co-targeting CXCR4 and immune checkpoints (PD-1/CTLA-4) in metastatic cancers .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cxcr4; Cmkar4; Lestr; Sdf1r; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Leukocyte-derived seven transmembrane domain receptor; LESTR; Pre-B-cell-derived chemokine receptor; PB-CKR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNRIFLPTIYFIIFLTGIVGNGL VILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTV NLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDFIFADVS QGDISQGDDRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVGISIDSFILLGVIKQGCDFESIVHKWISITEALAFF HCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4 is a receptor for the C-X-C chemokine CXCL12/SDF-1. It transduces signals by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. CXCR4 is involved in the AKT signaling cascade and plays a role in regulating cell migration, for example, during wound healing. It acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. CXCR4 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. It participates in hematopoiesis and cardiac ventricular septum formation. Additionally, CXCR4 plays a crucial role in the vascularization of the gastrointestinal tract, likely by regulating vascular branching and/or remodeling processes in endothelial cells. It is also involved in cerebellar development. In the CNS, CXCR4 may mediate hippocampal-neuron survival.
Gene References Into Functions
  1. Downregulation of CXCR4 by inducing small interfering RNA inhibits the proliferation of Th17 cells and promotes the expression of IL-6, IL-17, and IL-23. PMID: 30355939
  2. Superparamagnetic iron oxide nanoparticles stimulate CXCR4 (C-X-C chemokine receptor type 4) expression and CXCR4-SDF-1 (Stromal cell-derived factor 1) signaling in mesenchymal stem cells. PMID: 29734748
  3. Exosomes secreted from highly metastatic hepatocarcinoma-F cells promote Hca-P (low metastatic potential) cell migration and invasion, possibly through horizontal transfer of CXCR4. The exosomal CXCR4 released from Hca-F cells stimulates LECs proliferation and lymphangiogenesis, potentially due to SDF-1alpha/CXCR4 axis mediated MMP-9, MMP-2, and VEGF-C secretions. PMID: 30010038
  4. Findings suggest that periodontal CXCR4 signaling in several cell types in Porphyromonas gingivalis-induced periodontal inflammation depresses alveolar bone resorption in periodontitis. CXCR4 signaling might be a therapeutic target to prevent alveolar bone resorption in periodontitis. PMID: 29093284
  5. CXCL12-CXCR4 signaling is essential for the correct patterning of aortic arches and pulmonary arteries during development. PMID: 29016745
  6. Studies demonstrate that the CXCR4/CXCL12 axis can limit oxidative stress injury in hematopoietic stem cells (HSCs) by reducing mitochondrial oxidative stress. Disruption of the CXCR4 receptor in mice leads to increased endogenous production of reactive oxygen species, resulting in p38 MAPK activation, increased DNA double-strand breaks, and apoptosis, leading to a marked reduction in HSC repopulating potential. PMID: 27886253
  7. The Sdf-1 receptors, Cxcr4 and Cxcr7, as well as signaling pathways induced by these molecules in primary myoblasts and various stem cells, were investigated. PMID: 27736296
  8. Results provide evidence showing that CXCR4 plays a significant role in regulating biological functions associated with B16 liver metastasis. PMID: 28445180
  9. Using an RNA-mediated interference screen, phospholipase Cepsilon 1 (PLCepsilon1) was identified as a crucial regulator of stromal cell-derived factor 1 alpha (SDF-1alpha)-induced Rap1 activation. SDF-1alpha-induced activation of Rap1 is transient compared to the sustained level following cross-linking of the antigen receptor. PMID: 28213494
  10. Cardiac stem cells express CXCR4. Activation of c-kit signaling by SCF promotes migration of CSCs with increased phosphorylation of CXCR4-serine 339, p38 mitogen-activated protein kinase (p38 MAPK), and extracellular regulated protein kinases 1/2 (ERK1/2). PMID: 27245949
  11. Nitration on Tyr7 under inflammatory conditions is a novel natural posttranslational regulatory mechanism of CXCL12, which may downregulate the CXCR4-mediated inflammatory and tumor-promoting activities of CXCL12. PMID: 27566567
  12. Hyaluronic acid-laminin hydrogels increase neural stem cell transplant retention and migratory response to SDF-1alpha in a manner critically dependent on signaling via the SDF-1alpha-CXCR4 axis. PMID: 27645115
  13. The SDF-1-CXCR4 Axis in SP Cells-Mediated Protective Role for Renal Ischemia/Reperfusion Injury by SHH/GLI1-ABCG2 Pathway PMID: 27454381
  14. The pivotal role of CXCR4- and CXCR7-inhibition in acute pulmonary inflammation, which depended on A2B-receptor signaling, is reported. PMID: 28542132
  15. CXCR4 signaling is critical for perivascular invasion of GBM cells and radiation sensitivity. PMID: 27863376
  16. The results provide the first evidence that upregulation of TGFb/Smad3 in injured arteries induces local smooth muscle cells CXCR4 expression and cell migration, consequently leading to intimal hyperplasia. PMID: 27340942
  17. Results characterize CXCR4 as an important pathway that modulates immune dysfunction and mortality following sepsis, which may hold promise as a target for future therapeutic intervention in septic patients. PMID: 29232699
  18. CXCL12/CXCR4 signaling negatively modulates the bipotential state of Hemogenic endothelial cells independently of the hematopoietic fate. PMID: 27340788
  19. Efficient plasma cell differentiation and trafficking require Cxcr4 desensitization. PMID: 27681431
  20. High CXCR4 expression is associated with Prostate Cancer. PMID: 28687617
  21. Data show that FLT3 ligand (FLT3L) enhances thymopoiesis through increased survival and export of hematopoietic stem cell (Lin([minus])Sca1(+)c-Kit(+) [LSK] cells via CXCR4 receptor regulation. PMID: 28552733
  22. Adipocytes promoted osteoclast differentiation, function, and expression of adhesion-related molecules through the CXCL12/CXCR4 signaling pathway. PMID: 27868262
  23. Efficient Cxcr4 desensitization is critical for lymphoid differentiation of hematopoietic stem and progenitor cell (HSPC), and its impairment is a key mechanism underpinning the lymphopenia observed in mice and likely in WHIM Syndrome (WS) patients. PMID: 28550161
  24. COUP-TFI is required predominantly in Dentate gyrus progenitors for modulating expression of the Cxcr4 receptor during granule cell neurogenesis and migration. PMID: 28506990
  25. CXCR4, CCR2, and CX3CR1 direct dendritic cell precursors from the bone marrow to the lung differentially. PMID: 28148720
  26. Data suggest that prolonged but reversible pharmacologic blockade of the CXCR4/CXCL12 axis represents an approach that releases HSPC with efficiency superior to any other known mobilization strategy and may also serve as an effective method to expand the BM HSPC pool. PMID: 28400375
  27. Role of MIM in the homeostasis of BM cells, including HSPCs, through modulation of the CXCR4/SDF-1 axis and interactions of BM leukocytes with their microenvironments. PMID: 26965284
  28. Results suggest that SDF-1/CXCR4 signaling plays a significant role in the dynamics associated with adult sub-ventricular zone lineage cell proliferation and differentiation. PMID: 27288704
  29. Matn4 and cytokine receptor CXCR4 are involved in the regulation of hematopoietic stem cell proliferation and expansion under acute stress. PMID: 27573814
  30. This study demonstrates the multifaceted role of CXCR4 in defining BM monocyte heterogeneity and in regulating their function in peripheral tissues. PMID: 27811056
  31. This study shows that transmembrane TNF-alpha upregulates CXCR4 expression that promotes chemotaxis of myeloid-derived suppressor cells to tumor, and provides a new insight into a novel mechanism by which TNF-alpha facilitates tumor immune evasion. PMID: 28092866
  32. These data highlight AnxA1 as a novel determinant of neutrophil maturation and the mechanisms behind blood neutrophil homing to BM via the CXCL12/CXCR4 pathway. PMID: 26892496
  33. Irradiation enhances expression of cxcr4 in glioma cells via a HIF-1alpha-independent pathway. PMID: 24898400
  34. CXCL12/CXCR4 regulates HA and LG following corneal suture placement, and provides a novel strategy to inhibit LG. Notably, the present study is the first to demonstrate evidence that CXCL12/CXCR4 modulates LG in a corneal suture-induced mouse model. PMID: 27121088
  35. CXCR4 expression was significantly associated with a higher rate of metastasis and poor prognosis in patients with bone and soft tissue sarcoma. (Meta-analysis) PMID: 26678086
  36. The present study indicates that the CXCL12/CXCR4 signaling pathway is important during the development of cochleae in neonatal mice. PMID: 27052602
  37. Crosstalk between astrocytic CXCL12 and microglial CXCR4 in the pathogenesis of neuropathic pain. PMID: 27030717
  38. Results from using a plasmid transient expression of shRNA antiCXR4 shown that CXCR4 plays a critical role in the initial stages of development of murine melanoma B16F10 melanoma. PMID: 26883290
  39. DPP-4 inhibition may have direct protective effects on the post-myocardial infarction heart by inducing an antiapoptotic effect and inhibiting a decrease in vessel number through the SDF-1a/CXCR4-mediated STAT3 signaling pathway. PMID: 26739213
  40. Confirmation of a pivotal role of the SDF-1/CXCR4/CXCR7 axis for chronic allograft vasculopathy development. PMID: 26265085
  41. CXCR4 has an important role in endothelial progenitor cells migration at the ischemic site. PMID: 26620723
  42. CXCR4/CXCL12 signaling may control movement of epithelial progenitors from the dental stem cell niche. PMID: 26246398
  43. Our present study provided evidence that SDF-1 mediated CSCs migration through CXCR4 and CXCR7 via MEK/ERK and PI3K/Akt pathway. PMID: 26578388
  44. Endothelial CXCR4 is negatively regulated by miR-139-5p, whose transcription is in turn induced by laminar flow and APLN/APLNR signaling. PMID: 27068353
  45. CXCR4 signaling has a role in radiation-induced lung damage that promotes breast cancer lung-metastasis. PMID: 26396176
  46. Splenic TFF2, a secreted anti-inflammatory peptide, is released by vagally modulated memory T cells to suppress the expansion of myeloid-derived suppressor cells through CXCR4. PMID: 26841680
  47. CXCR4 inhibitor attenuates allergen-induced lung inflammation by down-regulating MMP-9 and ERK1/2 expression. PMID: 26261552
  48. CXCR4 regulates the acquisition of an EMT-like phenotype in extra-medullary myeloma. CXCR4 silencing leads to reduced tumor growth. PMID: 26190113
  49. Dimethyloxalylglycine up-regulates myocardial CXCR4 expression to improve cardiac function in myocardial infarction. PMID: 26519029
  50. The estradiol-CXCL12/CXCR4 signaling pathway may be useful in determining treatments for endometrial disorders, and may be antagonized to block stem cell migration to endometriosis. PMID: 25957946

Show More

Hide All

Database Links

KEGG: mmu:12767

STRING: 10090.ENSMUSP00000053489

UniGene: Mm.1401

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.
Tissue Specificity
Lymphocytes, macrophages, neutrophils, microglial cells and astrocytes. Found in spleen, thymus, bone marrow, lymph nodes and, at lower levels in brain, small intestine, stomach and kidney. CXCR4-A is predominant in all tissues tested. During embryonic de

Q&A

What is mouse CXCR4 and what are its primary functions in normal physiology?

Mouse CXCR4 is a seven-transmembrane G-protein-coupled receptor (GPCR) belonging to the CXC chemokine receptor family. It functions primarily as a receptor for the chemokine CXCL12 (also known as SDF-1α). CXCR4 is classified within the superfamily of G-protein-coupled receptors and possesses seven transmembrane helices that transmit signals from CXCL12 to intracellular biological pathways via heterotrimeric G-proteins .

In normal physiology, mouse CXCR4 plays critical roles in multiple processes including embryonic development, hematopoiesis, and immune cell trafficking. It regulates the migration of various cell types including hematopoietic stem cells, neural progenitors, and immune cells. CXCR4 assumes a pivotal role in B-cell development, ranging from early progenitors to the differentiation of antibody-secreting cells . Additionally, it facilitates leukocyte trafficking in lymphoid organs and inflammatory sites through interactions with CXCL12 .

How does mouse CXCR4 compare structurally and functionally to human CXCR4?

Mouse CXCR4 shares high sequence homology and functional similarity with human CXCR4, making mouse models valuable for translational research. Both receptors interact with CXCL12 as their primary ligand and couple to similar G-protein pathways, particularly Gi proteins. Like human CXCR4, mouse CXCR4 is involved in multiple physiological and pathological processes including hematopoiesis, immune responses, and cancer progression .

The structure of mouse CXCR4 closely resembles human CXCR4, with both featuring seven transmembrane domains characteristic of GPCRs, an extracellular N-terminus involved in ligand binding, and an intracellular C-terminus that participates in signaling. The high conservation of structure and function between species supports the use of mouse models for developing and testing CXCR4-targeted therapeutics with potential human applications.

What is the expression pattern of mouse CXCR4 in different tissues?

Mouse CXCR4 is widely expressed across multiple tissues and cell populations. It is predominantly expressed in hematopoietic and immune cells but is also found in neural tissues, heart, and kidney . Within the immune system, CXCR4 is expressed on:

  • B cells throughout their developmental stages

  • T cells, particularly CD4+ T cells

  • Neutrophils and macrophages

  • Hematopoietic stem and progenitor cells

In the spleen, CXCR4 is primarily found in CD4+ T cells, while in the liver, it's present in CD3+ T cells and macrophages . This diverse expression pattern reflects the receptor's multiple roles in different biological systems and contributes to its involvement in various physiological and pathological conditions.

What is the primary ligand for mouse CXCR4 and how does this interaction mediate signaling?

The primary ligand for mouse CXCR4 is CXCL12 (SDF-1α). When CXCL12 binds to CXCR4, it triggers conformational changes in the receptor that activate associated heterotrimeric G-proteins, particularly subtypes of the Gi family. Despite CXCR4's ability to form dimers, research has shown that it interacts with CXCL12 in a 1:1 stoichiometry .

The binding initiates various intracellular signaling cascades that regulate cell migration, proliferation, and survival. The CXCL12-CXCR4 signaling axis controls multiple physiological processes including:

  • Leukocyte trafficking to lymphoid organs

  • Stem cell migration during development and tissue repair

  • Cell adhesion and transendothelial migration

  • Regulation of tissue homeostasis and organogenesis

These signaling events are tightly regulated and are critical for normal development and immune function in mice.

What are the specifics of CXCR4 signaling mechanisms in mice?

CXCR4 signaling in mice involves several interconnected pathways following activation by CXCL12:

  • G-protein coupling preferences:

    • Studies using reconstituted systems have shown that mouse CXCR4 couples most efficiently with Gαi1 and Gαi2

    • Coupling to Gαi3 and Gαo is less efficient but still occurs

  • Downstream signaling cascades include:

    • Activation of PI3K/Akt pathway promoting cell survival

    • Stimulation of MAP kinase pathways driving proliferation

    • Regulation of small GTPases controlling cell migration

    • Calcium mobilization affecting various cellular functions

  • Regulatory mechanisms:

    • Receptor desensitization through β-arrestin recruitment

    • Internalization following ligand binding

    • Modulation by RGS (Regulator of G-protein Signaling) proteins

Experimental evidence shows that RGS proteins enhance CXCR4-mediated steady-state GTP hydrolysis, indicating that GTP hydrolysis becomes rate-limiting under conditions of agonist stimulation. Additionally, agonist stimulation of GTPase activity is sensitive to monovalent anions, possibly due to increases in G-protein GDP-affinity or interference with ligand/receptor interaction .

How does mouse CXCR4 interact with its ligand CXCL12 at the molecular level?

The molecular interaction between mouse CXCR4 and CXCL12 has been investigated using multiple complementary approaches including structural studies, mutagenesis, and computational modeling:

  • Binding stoichiometry and geometry:

    • Despite CXCR4's dimeric nature, it interacts with CXCL12 in a 1:1 stoichiometry

    • The interaction involves two distinct epitopes for recognition

    • Structural modeling informed by cysteine trapping experiments has enabled determination of the receptor:chemokine complex geometry

  • Key interaction domains:

    • The N-terminal domain of CXCR4 plays a crucial role in ligand binding

    • Extracellular loops of the receptor form important contacts with CXCL12

    • Specific amino acid residues within these domains create a binding pocket for CXCL12

  • Conformational changes:

    • Ligand binding induces structural rearrangements in the transmembrane helices

    • These changes propagate to the intracellular domains to facilitate G-protein coupling

    • Different ligands may induce distinct conformational states leading to biased signaling

This molecular understanding has helped resolve conflicting evidence from earlier structural and mutagenesis studies that suggested several possibilities for receptor:chemokine complex stoichiometry .

What methodologies are available for expressing and purifying recombinant mouse CXCR4?

Expression and purification of recombinant mouse CXCR4 presents several technical challenges due to its nature as a transmembrane protein. Successful methodologies include:

  • Expression systems:

    • Baculovirus-infected Sf9 insect cells have proven effective for CXCR4 expression

    • Infection of Sf9 cells with multiple baculoviruses (up to four) encoding different signal transduction proteins is feasible, allowing for systematic analysis of CXCR4/G-protein coupling

    • Mammalian expression systems (HEK293, CHO cells) for studies requiring mammalian post-translational modifications

  • Construct design considerations:

    • Addition of affinity tags for purification

    • Inclusion of fusion partners to improve stability

    • Codon optimization for the expression system

  • Purification strategies:

    • Careful selection of detergents for membrane extraction

    • Affinity chromatography using tagged constructs

    • Size exclusion chromatography for further purification

  • Functional reconstitution:

    • Reconstitution into lipid bilayers or nanodiscs for functional assays

    • Co-expression with G-proteins (particularly Gαi1 and Gαi2, which couple efficiently with CXCR4)

What functional assays are available to study recombinant mouse CXCR4 activity?

Several assays are available to evaluate the functional properties of recombinant mouse CXCR4:

  • G-protein activation assays:

    • High-affinity GTPase assay provides an excellent signal-to-noise ratio and constitutes a suitable test system for pharmacological analysis of CXCR4

    • [35S]GTPγS binding assay to detect G-protein activation

    • This approach assesses receptor/G-protein coupling at a proximal level under steady-state conditions without bias from downstream signaling non-linearity

  • Receptor binding assays:

    • Saturation binding with labeled ligands to determine affinity constants

    • Competition binding to assess inhibitor potency

    • Kinetic binding studies to determine association/dissociation rates

  • Signaling pathway analysis:

    • Measurement of cAMP inhibition (Gi pathway)

    • Calcium mobilization assays

    • ERK phosphorylation assays

    • β-arrestin recruitment assays

  • Functional cellular responses:

    • Migration assays (transwell, wound healing)

    • Cell proliferation and survival assays

    • Receptor internalization studies

The high-affinity GTPase assay is particularly valuable as it allows for pharmacological analysis without bias introduced by potential non-linearity of downstream signaling pathways, providing direct measurement of receptor-mediated G-protein activation .

How can computational approaches enhance mouse CXCR4 research?

Computational methods have become invaluable tools for CXCR4 research:

  • Molecular modeling and simulations:

    • All-atom molecular dynamics simulations in explicit membrane-water environments provide insights into receptor dynamics and ligand interactions

    • Coarse-grained models allow simulation of larger systems or longer timescales

    • Homology modeling using related receptor structures as templates

  • Ligand binding and screening:

    • Virtual screening to identify potential CXCR4-binding molecules

    • Docking studies to predict binding modes and interaction energies

    • Structure-based drug design for optimizing CXCR4 inhibitors

  • Applications in structure determination:

    • Model validation through comparison with experimental data

    • Integration with experimental restraints from mutagenesis or crosslinking

    • Refinement of low-resolution structural models

  • Case study - EPI-X4 binding mode:

    • Computational approaches helped determine how EPI-X4 (an endogenous peptide antagonist) interacts with CXCR4

    • Multiple binding poses were generated through docking and homology modeling

    • Molecular dynamics simulations in membrane environments refined these models

    • The resulting computational model was validated by mutagenesis and activity studies

These computational approaches provided the foundation for designing shortened EPI-X4 derivatives (7-mers) with optimized receptor antagonizing properties as new leads for CXCR4 inhibitor development .

How can recombinant mouse CXCR4 be used for development and testing of CXCR4-targeted therapeutics?

Recombinant mouse CXCR4 serves as a valuable tool for therapeutic development through several approaches:

  • Antagonist screening and development:

    • The GTPase assay system provides an excellent signal-to-noise ratio for testing CXCR4 antagonists

    • This system is valuable for characterizing CXCR4 antagonists with potential applications in treating autoimmune diseases and tumors

    • Structure-based drug design leveraging CXCR4 structural data

    • Optimization of EPI-X4 derivatives (endogenous CXCR4 antagonist)

  • Therapeutic targets under investigation:

    • Cancer: Inhibition of metastasis and tumor-stromal interactions

    • Inflammatory diseases: Reduction of pathological immune cell recruitment

    • HIV infection: Blocking of viral entry via CXCR4 co-receptor

    • Stem cell mobilization for transplantation

  • Methodological considerations:

    • Parallel testing on mouse and human CXCR4 to assess cross-species activity

    • Reconstituted systems for measuring G-protein activation

    • Cellular assays for downstream signaling events

  • Development of EPI-X4 derivatives:

    • EPI-X4, a 16-mer fragment of albumin, is a specific endogenous antagonist and inverse agonist of CXCR4

    • Computational modeling combined with experimental validation has led to shortened 7-mer derivatives with optimized receptor antagonizing properties

    • These derivatives represent promising leads for treating CXCR4-linked disorders such as cancer or inflammatory diseases

The development of CXCR4 inhibitors is particularly important for overcoming viral drug resistance against CCR5 inhibitors in HIV treatment and reducing the occurrence of transitional intermediate variants that can successfully switch to CXCR4-using variants .

What are the challenges in studying mouse CXCR4 in vivo and in vitro?

Research on mouse CXCR4 faces several technical and biological challenges:

  • Technical challenges in protein expression and handling:

    • Membrane protein instability outside native environments

    • Difficulty capturing transient receptor states

    • Complexity of reconstituting complete signaling complexes

    • Limited tools for studying native CXCR4 in situ

  • Experimental limitations:

    • Potential differences between recombinant systems and native expression

    • Influence of expression system on post-translational modifications

    • Maintaining receptor functionality during purification and reconstitution

    • Accounting for species-specific differences when translating findings

  • In vivo challenges:

    • Embryonic lethality of complete CXCR4 knockout necessitating conditional approaches

    • Redundancy in chemokine signaling pathways

    • Contextual differences in CXCR4 function across tissues and developmental stages

    • Technical difficulties in imaging CXCR4-dependent processes in living animals

  • Solutions and innovative approaches:

    • Stabilized receptor constructs through protein engineering

    • Advanced membrane mimetics (nanodiscs, lipid cubic phase)

    • Cell-specific conditional knockout/knockin models

    • Complementation strategies for functional studies

For example, functional complementation experiments with multiple pairs of complementary nonfunctional CXCR4 mutants have been used to probe receptor stoichiometry hypotheses, while the strategy of dimer dilution has explored the importance of wild-type CXCR4 dimers .

What are the emerging techniques for studying CXCR4 dynamics and interactions?

Recent technological advances have expanded the toolbox for investigating CXCR4:

  • Advanced structural approaches:

    • Cryo-electron microscopy for high-resolution structures

    • Single-particle analysis of receptor complexes

    • Time-resolved structural methods to capture signaling intermediates

  • Cutting-edge biophysical methods:

    • Single-molecule tracking of receptor movement in membranes

    • Super-resolution microscopy for visualizing receptor organization

    • Conformational biosensors to monitor receptor activation states

    • Hydrogen-deuterium exchange mass spectrometry for mapping dynamic interactions

  • Genome editing technologies:

    • CRISPR/Cas9-mediated generation of specific mutations or variants

    • Knock-in of fluorescent or affinity tags at endogenous loci

    • Site-specific integration of modified CXCR4 variants

  • Systems biology approaches:

    • Multi-omics analysis of CXCR4 signaling networks

    • Mathematical modeling of receptor dynamics

    • Integration of computational and experimental datasets

These emerging techniques are providing unprecedented insights into CXCR4 biology and paving the way for more precise therapeutic interventions targeting this receptor.

What are the most promising directions for future CXCR4 research?

Future research on mouse CXCR4 is likely to focus on several promising areas:

  • Structural and functional characterization:

    • Higher resolution structures of CXCR4 in complex with diverse ligands

    • Enhanced understanding of the dynamics of receptor activation and signaling

    • Deeper insights into CXCR4 heterodimer formation and functional consequences

  • Therapeutic development:

    • Design of biased ligands that selectively activate beneficial pathways

    • Development of tissue-specific CXCR4 modulators

    • Creation of small molecule inhibitors with improved pharmacokinetic properties

    • Optimization of EPI-X4 derivatives as novel therapeutic agents

  • Physiological roles:

    • Tissue-specific functions of CXCR4 in development and homeostasis

    • Cell type-specific signaling outcomes and their regulation

    • Context-dependent roles in health and disease

  • Translational applications:

    • Improved mouse models for human diseases involving CXCR4

    • Development of imaging agents targeting CXCR4 for diagnostic applications

    • Combinatorial approaches targeting CXCR4 alongside other therapeutic targets

The continued investigation of mouse CXCR4 using integrated experimental and computational approaches will likely yield valuable insights with translational potential for human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.