Recombinant Mouse C2 domain-containing protein 2-like (C2cd2l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will fulfill requests as best as possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees will apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its use.

Synonyms
C2cd2l; Tmem24; Phospholipid transfer protein C2CD2L; C2 domain-containing protein 2-like; Transmembrane protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
C2cd2l
Target Protein Sequence
MDPDWGQRDVGWAALLVLFAASLITVLGWMLQYARGLWLSRADGGRDSRPASAAEPGGSL RELGVWRSLLRLRATRTSTPEEAGVRGLLASLFAFKSFRENWQRAWVRALNEQACRDGSS IQIAFEEIPQLPPRASISHVTCVDQSERTMVLHCQLSAEEVRFPISVTQQSPAAVSMETY HVTLTLPPTQLEVSLEEIPDEGLLVSWAFTDRPELSLKVLPKLQTRERDEEQPELSTVEE LIKDAIVSTQPAMMVNLRACSAPGGLVPSEKPPTMSQAQPSIPRPTRLFLRQLRASHLGS ELGGTEELCCAAELDNPMQQKWTKPMRAGPEVEWTEDLALDLGPQSRELTLKVLRSSSCG DAELLGQATLPVGSPSRPMSRRQVCPLTPGPGKSLSPAATVTAELHYEQGSPRNLGTPTS STPRPSITPTKKIELDRTIMPDGTVVTTVTTVQSRPRVDGKLDSPSRSPSKVEVTEKMTT VLSESSGPSNASHSSSRESHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISGVS KVPIAQDELVLSLGYAASLEASMQDDAGTSGGPSSPPSDPSATSPGPVDALSSPTSVQEA DETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLS QSHDDLSNTTATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL
Uniprot No.

Target Background

Function

Recombinant Mouse C2 domain-containing protein 2-like (C2cd2l) is a lipid-binding protein that transports phosphatidylinositol, the precursor of phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2), from its synthesis site in the endoplasmic reticulum to the cell membrane. This action maintains the cell membrane phosphoinositide pool, which is degraded during phospholipase C (PLC) signaling. It plays a crucial role in coordinating Ca2+ and phosphoinositide signaling, localizing to endoplasmic reticulum-cell membrane contact sites where it tethers the two bilayers. Upon cytosolic Ca2+ elevation, it undergoes C-terminal phosphorylation and dissociates from the cell membrane, halting phosphatidylinositol transport. It positively regulates glucose-stimulated insulin secretion. Phosphatidylinositol transfer to the cell membrane replenishes PI(4,5)P2 pools and opens calcium channels, priming insulin granule release.

Gene References Into Functions
  1. Differential C2CD2L, DIRAS2, and PYCR2 protein expression levels in the prefrontal neocortex of male M. fascicularis correlate with varying degrees of voluntary alcohol consumption. C2CD2L findings were confirmed in chronically, intermittently ethanol-treated BXD mouse strains, where the D allele (DBA/2) was linked to lower alcohol consumption than the B allele (C57BL/6J). PMID: 28270566
  2. The identification of TMEM24 within a comprehensive series of sequential insulin-binding partners provides a detailed molecular description of the insulin secretory pathway in beta cells. PMID: 24012759
Database Links

KEGG: mmu:71764

UniGene: Mm.491174

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cell membrane; Peripheral membrane protein.

Q&A

What is C2cd2l and how does it relate to TMEM24?

C2cd2l (C2 domain-containing protein 2-like) and TMEM24 are identical proteins, with TMEM24 being the more commonly used name in neuronal research. It functions as an endoplasmic reticulum (ER)-anchored lipid transfer protein that mediates the formation of ER-plasma membrane (ER-PM) junctions, particularly at sites of cell-cell contacts . The protein contains a transmembrane domain that anchors it to the ER and a C-terminal region (CTR) with polybasic clusters that interact with the plasma membrane .

What is the tissue distribution pattern of C2cd2l compared to its paralog C2CD2?

C2cd2l/TMEM24 and C2CD2 exhibit markedly different tissue distribution patterns despite their structural similarities. C2cd2l is highly enriched in brain tissue, consistent with its role in neuronal signaling . In contrast, C2CD2 is barely detectable in brain tissue but is significantly enriched in liver, with moderate expression levels in pancreatic islets and testis . This differential expression pattern suggests tissue-specific functions for these paralogous proteins.

How can researchers visualize C2cd2l localization in cells?

Researchers can visualize C2cd2l localization using several methodological approaches:

  • Fluorescent protein tagging: Creating C2cd2l-EGFP fusion proteins allows for live-cell imaging and can reveal its distribution at ER-PM junctions .

  • Immunofluorescence: Using specific antibodies against C2cd2l for fixed-cell microscopy.

  • Co-localization studies: Combined with ER markers (such as RFP-KDEL) to confirm its presence throughout the ER and enrichment at ER-PM contact sites .

  • Super-resolution microscopy: For detailed analysis of C2cd2l clustering at contact sites.

These approaches have revealed that C2cd2l localizes throughout the ER but shows significant enrichment at cortical ER-PM contact sites .

How is C2cd2l dynamically regulated at ER-PM contact sites?

C2cd2l exhibits dynamic regulation at ER-PM contact sites, particularly in response to calcium signals. Upon elevation of cytosolic calcium levels (such as during treatment with thapsigargin), C2cd2l-EGFP dissociates from the plasma membrane and then reassociates minutes later . This regulation appears to be mediated by phosphorylation events, as the C-terminal region contains PKC consensus sites . Importantly, this calcium-dependent regulation distinguishes C2cd2l from its paralog C2CD2, which does not exhibit obvious dissociation from the PM in response to calcium elevation .

What protein complexes does C2cd2l form at cell-cell contact sites?

Based on unbiased proximity ligation analysis, C2cd2l/TMEM24 forms a complex with band 4.1 family members at cell-cell contact sites . These band 4.1 proteins can in turn bind to various plasma membrane proteins, including cell adhesion molecules such as SynCAM 1 . This interaction network facilitates the enrichment of C2cd2l-containing ER-PM junctions specifically at sites of cell contacts . Additionally, C2cd2l can form complexes with its paralog C2CD2, though they have different regulatory properties .

How do the molecular interactions of C2cd2l affect its function in calcium regulation?

The molecular interactions of C2cd2l at ER-PM junctions play a critical role in calcium signaling and homeostasis. When C2cd2l is present at cell-adjacent junctions as part of a protein complex with band 4.1 family members, it exhibits different dynamic properties compared to non-cell adjacent junctions . Specifically, C2cd2l at cell-adjacent junctions is not shed by calcium rise, unlike C2cd2l at non-cell adjacent junctions . This differential regulation suggests that cell-contact interactions can modulate C2cd2l-dependent calcium signaling and potentially phospholipid transfer between membranes .

What are the key methodological approaches for studying C2cd2l function?

Researchers can employ several methodologies to study C2cd2l function:

  • Loss- and gain-of-function experiments: Knockdown or overexpression of C2cd2l to assess its role in cellular processes .

  • Calcium imaging combined with live-cell microscopy: To monitor C2cd2l dynamics in response to calcium fluctuations .

  • Pharmacological perturbations: Using agents like thapsigargin to elevate cytosolic calcium and observe C2cd2l translocation .

  • Mutational analysis: Creating mutations in key regulatory sites (e.g., PKC phosphorylation sites) to assess their impact on C2cd2l function .

  • Protein-protein interaction studies: Co-immunoprecipitation or proximity ligation assays to identify C2cd2l binding partners .

  • Lipidomic approaches: To identify and quantify the lipids transported by C2cd2l between membranes.

What controls should be included when studying recombinant C2cd2l in experimental systems?

When working with recombinant C2cd2l, researchers should consider the following controls:

  • Paralog comparison: Include C2CD2 as a related protein with similar domain organization but different regulation .

  • Domain truncation experiments: Test isolated domains (e.g., CTR alone) to understand their specific contributions to function .

  • Calcium-insensitive mutants: Create phosphorylation site mutants that do not respond to calcium signals for comparison with wild-type protein .

  • Tissue-appropriate expression: Consider the natural tissue distribution of C2cd2l (brain-enriched) when selecting cellular models .

  • Activity controls: Include measurements of specific activity when assessing protein function, similar to approaches used for other recombinant proteins .

What is known about C2cd2l's role in cancer biology?

Recent research has implicated C2cd2l in cancer progression, particularly in triple-negative breast cancer (TNBC). A novel long non-coding RNA (lncRNA) called AC112721.1 has been shown to function as a competing endogenous RNA (ceRNA) by sponging miR-491-5p, which increases the expression of C2cd2l . This regulatory mechanism appears to influence TNBC progression, as demonstrated through loss- and gain-of-function experiments that showed effects on cell proliferation, migration, and apoptosis both in vitro and in vivo . These findings suggest that C2cd2l may represent a potential biomarker for evaluating TNBC prognosis and could be a target for therapeutic intervention .

How can researchers investigate the potential therapeutic targeting of C2cd2l?

Researchers interested in exploring C2cd2l as a therapeutic target might consider the following approaches:

  • Expression analysis: Examine C2cd2l expression levels across different cancer types and correlate with clinical outcomes .

  • Pathway analysis: Investigate how C2cd2l regulates signaling pathways (such as the Ras pathway) that are relevant to disease progression .

  • RNA interference: Use siRNA or shRNA to specifically downregulate C2cd2l and assess effects on disease-relevant phenotypes .

  • Drug screening: Identify small molecules that modulate C2cd2l function or its interactions with binding partners.

  • Animal models: Develop and characterize transgenic mouse models with altered C2cd2l expression to study its role in disease contexts.

  • Biomarker development: Evaluate whether C2cd2l levels could serve as a prognostic or predictive biomarker for TNBC or other conditions .

How does C2cd2l contribute to lipid transport between membranes?

C2cd2l functions as a phospholipid transporter at ER-PM contact sites, facilitating the non-vesicular transfer of lipids between these membranes . This lipid transfer activity is likely mediated by its SMP domain, which can bind and transport lipids . The functional significance of this lipid transport is particularly important in neurons, where it appears to participate in the control of neuronal signaling . The calcium-dependent regulation of C2cd2l localization at the PM suggests that its lipid transfer activity may be dynamically regulated in response to cellular signaling events . Further research using lipidomic approaches and in vitro lipid transfer assays could help elucidate the specificity and kinetics of C2cd2l-mediated lipid transport.

What are the critical differences in the regulation of C2cd2l versus C2CD2?

Despite their structural similarities, C2cd2l/TMEM24 and C2CD2 exhibit significant differences in their regulation:

  • Calcium response: C2cd2l dissociates from the PM when exposed to thapsigargin (which increases cytosolic calcium) and then reassociates minutes later, whereas C2CD2 does not exhibit an obvious dissociation .

  • Phosphorylation sites: The CTR of C2cd2l contains multiple PKC consensus sites, while C2CD2 has only two residues (one serine and one threonine) in its C-terminal basic stretch that fit the PKC consensus with a confidence value >0.6 .

  • Tissue-specific expression: C2cd2l is brain-enriched, while C2CD2 is liver-enriched with minimal brain expression .

These regulatory differences suggest that despite their similar domain organization, these paralogous proteins have evolved distinct functions in different tissues and cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.