Recombinant Mouse Calcitonin gene-related peptide type 1 receptor (Calcrl)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Calcitonin Gene-Related Peptide Type 1 Receptor (Calcrl) is a purified, full-length protein expressed in E. coli, designed for research into CGRP and adrenomedullin signaling pathways. This receptor forms functional complexes with Receptor Activity-Modifying Proteins (RAMPs) to mediate diverse physiological roles, including vasodilation, osteogenesis, and neural modulation .

Primary Structure

  • Amino Acid Sequence: Comprises residues 23–463 (UniProt ID: Q9R1W5) fused to an N-terminal His tag .

  • Molecular Features:

    • Molecular weight: ~52 kDa (calculated).

    • Purity: >90% by SDS-PAGE .

ParameterSpecification
SpeciesMus musculus (Mouse)
Expression SystemE. coli
TagN-terminal His tag
Protein Length441 amino acids (mature protein)
Storage BufferTris/PBS, 6% Trehalose, pH 8.0
Reconstitution Guidance0.1–1.0 mg/mL in sterile water + glycerol

Post-Translational Features

  • Requires RAMP1 for cell surface expression and CGRP binding .

  • Forms a heterodimeric complex with RAMP1 to function as a CGRP receptor .

Signaling Pathways

  • cAMP Activation: Binds CGRP to activate Gαs-coupled pathways, elevating intracellular cAMP .

  • ERK Modulation: Regulates extracellular signal-regulated kinase (ERK) signaling, influencing cell proliferation and differentiation .

Ligand Specificity

  • CGRP Binding: High affinity for CGRP (Kd=2.2×1010K_d = 2.2 \times 10^{-10} M) when co-expressed with RAMP1 .

  • Adrenomedullin Interaction: Binds adrenomedullin with RAMP2/3, altering vascular tone .

Role in Periodontal Tissue Regeneration

  • Expression in Periodontal Ligament (PDL) Cells:

    • Ramp1 and Calcrl mRNA are upregulated during osteogenic differentiation of mouse PDL cells .

    • Enhances Osterix, Alp, and Osteocalcin expression, promoting mineralization .

  • Mechanism: CGRP-Calcrl signaling increases BMP-2 and Wnt/β-catenin activity, critical for bone repair .

Vascular Regulation

  • Vasodilation: Mediates nitric oxide (NO) and prostaglandin release in endothelial cells under shear stress .

  • Clinical Relevance: CALCRL variants (e.g., rs880890) correlate with impaired angiogenesis and coronary artery disease risk .

Experimental Use Cases

  • CGRP Receptor Antagonist Screening: Used to evaluate inhibitors for migraine therapy .

  • Bone Metabolism Studies: Investigates osteoblast differentiation and bone resorption pathways .

Limitations and Considerations

  • Species Specificity: Mouse Calcrl exhibits 89% sequence identity with human orthologs .

  • Functional Dependency: Requires RAMP co-expression for ligand binding .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Calcrl; Crlr; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-463
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ESEEGVNQTDLGVTRNKIMTAQYECYQKIMQDPIQQAEGLYCNRTWDGWLCWNDVAAGTE SMQYCPDYFQDFDPSEKVTKICDQDGHWFRHPDSNRTWTNYTLCNNSTHEKVKTALNLFY LTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFICNSIVTIIHLTAVANNQA LVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWYYFLGWGFP LLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVT HQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVAEEVYDYVMHILMHFQGLLVATI FCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDMQGYSHDCPTEHLNG KSIQDIENVALKSENMYDLVM
Uniprot No.

Target Background

Function
This receptor, when paired with RAMP1, serves as the receptor for calcitonin-gene-related peptide (CGRP). It also functions as the receptor for adrenomedullin when paired with either RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins, which activate adenylyl cyclase.
Gene References Into Functions
  1. A study revealed a Notch-Collagen V-Calcitonin receptor signaling cascade that maintains satellite cells in a quiescent state in a cell-autonomous fashion. This raises the possibility that similar reciprocal mechanisms operate in diverse stem cell populations. PMID: 29795344
  2. Mouse and human heart valves expressed mRNAs for the CRL ligands adrenomedullin (AM), adrenomedullin-2 (AM-2), and calcitonin gene-related peptide (CGRP), along with their receptor components, i.e., CRL and receptor-activity-modifying proteins 1-3. PMID: 27553639
  3. These data suggest that the structural integrity of caveolae plays a crucial role in regulating the subcellular distribution of CLR. PMID: 24032687
  4. Calcrl deficiency leads to multi-organ lymphangiectasia in adult mice. PMID: 23028890
  5. The Calcrl gene targeted mice provide the first in vivo genetic evidence that the Calcitonin receptor functions as an Adrenomedullin receptor during embryonic development. PMID: 16537897
  6. Loss of calcrl in endothelial cells confirmed an essential role for AM signaling in vascular development. PMID: 18097475

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in the lung, thymus, heart and brain.

Q&A

What is the molecular structure of mouse Calcrl and how does it differ from human Calcrl?

Mouse Calcitonin receptor-like receptor (mCRLR) is a 462-amino acid G protein-coupled heptahelical receptor that requires association with receptor activity modifying protein 1 (mRAMP1), a 148-amino acid single membrane-spanning protein with a short cytoplasmic portion, to form a functional CGRP receptor . The receptor complex exhibits a binding affinity (Kd) of 2.2 × 10⁻¹⁰ M for CGRP ligand .

When comparing mouse Calcrl to human Calcrl, both maintain the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors, though species-specific variations in amino acid sequences exist. These differences should be considered when designing cross-species experiments or extrapolating results between mouse models and human applications .

How can I verify the expression and functionality of recombinant mouse Calcrl in experimental systems?

To verify expression and functionality of recombinant mouse Calcrl, a multi-method approach is recommended:

  • Western blot analysis: When properly expressed, antibodies such as anti-CALCRL 8H9L8 can detect a prominent band at approximately 66 kDa, with weaker bands at ~130 kDa (likely receptor dimers) and ~82 kDa (potentially RAMP-coupled Calcrl) .

  • Functional binding assays: Specific binding of ¹²⁵I-CGRP should only be detectable when both mCRLR and mRAMP1 cDNAs are co-transfected into cells (e.g., COS-7 cells) .

  • cAMP elevation assay: Functional Calcrl/RAMP1 complexes respond to CGRP stimulation with marked elevation of intracellular cAMP levels .

  • Promoter activity assays: Verify downstream signaling by measuring increased promoter activities of cyclic AMP responsive element and serum responsive element in response to CGRP .

  • siRNA knockdown controls: Include siRNA-mediated silencing of Calcrl expression as a negative control to validate antibody specificity .

What are the optimal expression systems for producing functional recombinant mouse Calcrl?

For producing functional recombinant mouse Calcrl, consider these expression systems with their respective advantages:

Expression SystemAdvantagesKey Considerations
COS-7 cellsDemonstrated success in co-expression studies; efficient for transfectionRequires co-transfection with mRAMP1 for functional expression
HeLa cellsSuitable for promoter activity assays; good for studying downstream signalingEffective for evaluating cAMP responsive element activity
BON-1 cellsEndogenously express CALCRL; useful for protein interaction studiesGood model for studying natural Calcrl expression patterns

Critical methodological considerations include:

  • Always co-express mRAMP1 with mCRLR, as specific binding of CGRP is only detected when both are present

  • Verify protein expression using Western blot analysis with specific antibodies

  • Confirm functionality through binding assays and signal transduction measurements

  • Consider using His-tagged constructs for easier purification and detection

How do RAMP1-Calcrl interactions affect ligand binding specificity and signal transduction pathways?

The interaction between Calcrl and RAMP1 is fundamental to receptor function and significantly influences both ligand specificity and downstream signaling. When mCRLR associates with mRAMP1, it forms a functional CGRP receptor with high affinity for CGRP ligands (Kd = 2.2 × 10⁻¹⁰ M) .

This complex activates multiple signaling pathways:

  • cAMP/PKA pathway: CGRP binding to the mCRLR/mRAMP1 complex induces a marked elevation of intracellular cAMP levels, activating the protein kinase A (PKA) pathway .

  • MAPK/ERK pathway: The receptor complex also activates the extracellular signal-regulated kinase (ERK) pathway, as evidenced by increased serum responsive element (SRE) promoter activity in transfected cells .

Methodologically, researchers can investigate these interactions through:

  • Co-immunoprecipitation experiments to analyze physical interactions

  • Double-labeling immunohistochemistry to visualize co-localization of Calcrl with different RAMP isoforms in tissue samples

  • Site-directed mutagenesis to identify critical residues involved in complex formation

  • FRET or BRET assays to study real-time interactions and conformational changes

The Calcrl-RAMP1 interaction represents a critical example of receptor-accessory protein complexes that modify GPCR pharmacology, making it an important model for studying how membrane protein interactions influence signal transduction mechanisms .

What are the methodological challenges in studying Calcrl expression patterns across different tissues?

Studying Calcrl expression patterns across tissues presents several methodological challenges that researchers must address:

  • Antibody specificity: Ensuring antibody specificity is crucial, as demonstrated by validation studies using peptide competition assays and siRNA knockdown experiments . Researchers should verify antibody specificity through Western blot analysis and include proper controls, such as preadsorption with immunizing peptides and silencing with specific siRNAs .

  • Heterodimeric nature: Since functional Calcrl requires association with RAMP proteins, detecting the receptor alone may not correlate with functional activity. Double-labeling immunohistochemistry for both Calcrl and RAMPs provides more complete information about the presence of functional receptor complexes .

  • Species differences: Expression patterns may vary between species, necessitating comparative studies. When using antibodies across species, cross-reactivity should be verified for rat, mouse, and human tissues to detect possible species-specific differences .

  • Cell-type specific expression: Within tissues, Calcrl expression can be highly cell-type specific. For instance, in duodenal epithelium, neuroendocrine cells show particularly intense staining compared to surrounding cells . Single-cell analysis techniques may be required for accurate characterization.

  • Quantification methods: For quantitative assessment of expression levels, researchers should employ qRT-PCR with carefully designed primers and probes, using reference genes appropriate for the tissue being studied .

How is Calcrl expression linked to disease progression in acute myeloid leukemia (AML) and what experimental approaches best demonstrate this relationship?

Calcrl has emerged as a significant prognostic factor in acute myeloid leukemia (AML), particularly in AML/ETO+ subtypes. Research indicates several key associations:

  • Prognostic significance: Expression of CALCRL is an independent prognostic factor in pediatric AML and is linked with relapse risk, supporting its role as a master regulator of relapse-initiating drug-tolerant cells .

  • Biological significance: As a G-protein-coupled neuropeptide receptor, CALCRL is involved in critical biological processes including colony formation and drug resistance .

Experimental approaches to investigate this relationship include:

  • Clinical correlation studies:

    • Analyze CALCRL expression levels in bone marrow samples from AML patients using qRT-PCR

    • Compare expression between AML/ETO+ patients and individuals with non-malignant hematological diseases

    • Correlate expression levels with clinical outcomes using Kaplan-Meier survival analysis and multivariable Cox proportional hazards models

  • Functional studies:

    • Silence CALCRL expression in AML cell lines using siRNA to assess effects on proliferation, colony formation, and drug sensitivity

    • Overexpress CALCRL to determine if it confers resistance to chemotherapeutic agents

    • Investigate downstream signaling pathways activated in CALCRL-expressing AML cells

  • Database analysis approach:

    • Utilize publicly available datasets like TCGA and GEO to analyze CALCRL expression across large patient cohorts

    • Perform Kaplan-Meier survival analysis with log-rank tests to compare survival between different expression groups

    • Calculate hazard ratios with 95% confidence intervals to quantify risk associations

Research findings indicate that CALCRL could serve as a suitable prognostic factor for designing chemotherapy regimens and evaluating the risk of hematopoietic stem cell transplantation in AML/ETO+ AML patients .

What approaches can resolve contradictions in Calcrl experimental data across different model systems?

Resolving contradictions in Calcrl experimental data across different model systems requires systematic methodological approaches:

  • Standardized expression analysis:

    • Employ consistent detection methods across models (Western blot, qRT-PCR, immunohistochemistry)

    • Use the same antibodies or validated equivalent antibodies across studies

    • Include appropriate positive and negative controls in each experiment

  • Complete characterization of receptor complexes:

    • Always assess both Calcrl and RAMP expression, as functional receptors require both components

    • Perform double-labeling immunohistochemistry to visualize co-localization of CALCRL and each RAMP isoform

    • Conduct binding studies to confirm functionality of receptor complexes

  • Cross-species validation:

    • When contradictory results appear between species, conduct parallel experiments using identical methodologies

    • Analyze sequence homology and structural differences that might explain functional variations

    • Consider evolutionary conservation of signaling pathways when interpreting differences

  • Integrated data analysis:

    • Utilize meta-analysis techniques to systematically review conflicting literature

    • Apply statistical methods appropriate for heterogeneous data

    • Consider factors such as cell type, experimental conditions, and genetic background when comparing results

  • Reproducibility assessment:

    • Test key findings across multiple cell lines and primary tissues

    • Validate results using complementary techniques (e.g., supporting protein expression data with mRNA analysis)

    • Collaborate across laboratories to independently verify controversial findings

When analyzing contradictory data , researchers should consider that variations might reflect true biological differences rather than experimental artifacts, particularly given the context-dependent nature of GPCR signaling and the heterodimeric composition of functional Calcrl receptors.

What are the optimal conditions for reconstituting functional recombinant mouse Calcrl in membrane systems?

For successful reconstitution of functional recombinant mouse Calcrl in membrane systems, consider these optimized conditions:

  • Co-expression requirements:

    • Always co-express mCRLR with mRAMP1, as specific binding of CGRP is only detected when both components are present

    • Maintain appropriate stoichiometric ratios between Calcrl and RAMP1 expression constructs

  • Expression system selection:

    • COS-7 cells have demonstrated successful co-expression of mCRLR and mRAMP1

    • Consider using His-tagged constructs for ease of purification and detection

  • Binding assay optimization:

    • For radioligand binding, ¹²⁵I-CGRP can be used to detect specific binding

    • Optimal binding is achieved with a Kd value of approximately 2.2 × 10⁻¹⁰ M

  • Functional verification:

    • Confirm functionality through cAMP elevation assays following CGRP stimulation

    • Measure promoter activities of cyclic AMP responsive element and serum responsive element in transfected cells

  • Protein purification considerations:

    • When using His-tagged constructs, optimize imidazole concentration in elution buffers

    • Consider detergent selection carefully as it can affect receptor conformation and activity

    • Native-like membrane environments (nanodiscs, liposomes) may better preserve functionality than detergent solutions

How can I design experimental controls to validate the specificity of Calcrl antibodies in various applications?

Designing robust experimental controls for validating Calcrl antibody specificity is crucial for reliable results across applications:

  • Western blot validation:

    • Peptide competition assays: Preincubate antibody with immunizing peptide to demonstrate signal abolishment

    • Non-specific peptide controls: Preincubate with control peptides to demonstrate specificity

    • Expected band patterns: For Calcrl, look for a strong band at ~66 kDa, with potential weaker bands at ~130 kDa (dimers) and ~82 kDa (RAMP-coupled)

  • Genetic knockdown/knockout controls:

    • siRNA silencing: Transfect cells with Calcrl-specific siRNA to demonstrate signal reduction

    • Scrambled siRNA: Use as negative control to confirm specificity of knockdown

    • CRISPR/Cas9 knockout: Generate complete knockout cell lines as definitive negative controls

  • Immunohistochemistry controls:

    • Tissue-specific expression patterns: Verify antibody recognizes established expression patterns in reference tissues

    • Double-labeling: Perform co-staining with RAMP1, RAMP2, or RAMP3 to confirm detection of physiologically relevant receptor complexes

    • Signal specificity: Include controls of secondary antibody alone and isotype control antibodies

  • Cross-species reactivity assessment:

    • Test antibody performance across human, mouse, and rat samples to evaluate cross-reactivity

    • Compare staining patterns between species to identify conserved and divergent expression

  • Recombinant protein controls:

    • Use purified recombinant Calcrl protein as a positive control

    • Include related receptors (e.g., calcitonin receptor) to confirm absence of cross-reactivity

What strategies can optimize signal detection in functional assays of recombinant mouse Calcrl?

Optimizing signal detection in functional assays of recombinant mouse Calcrl requires tailored approaches to enhance sensitivity and specificity:

  • cAMP assay optimization:

    • Use phosphodiesterase inhibitors (e.g., IBMX) to prevent cAMP degradation

    • Consider FRET-based or luminescence-based assays for improved sensitivity over traditional methods

    • Determine optimal cell density and CGRP concentration ranges through dose-response experiments

  • Promoter activity assays:

    • Select appropriate reporter constructs with cyclic AMP responsive elements or serum responsive elements

    • Optimize transfection efficiency through method selection and ratio adjustments

    • Include positive controls (forskolin for cAMP pathways) and negative controls (untransfected cells)

  • Calcium mobilization assays:

    • Use calcium-sensitive fluorescent dyes (Fluo-4, Fura-2) for real-time monitoring

    • Calibrate signals against known calcium concentrations

    • Consider automated plate reader systems for higher throughput

  • ERK pathway activation:

    • Determine optimal time points for phospho-ERK detection after CGRP stimulation

    • Use phospho-specific antibodies for Western blotting or ELISA-based detection

    • Include positive controls (growth factors) to verify assay functionality

  • Receptor internalization assays:

    • Label recombinant Calcrl with fluorescent tags for visualization

    • Optimize imaging parameters for confocal microscopy

    • Consider automated image analysis for quantification of internalization

  • Co-expression considerations:

    • Always co-express mRAMP1 with mCRLR for functional studies, as specific CGRP binding requires both components

    • Verify co-expression through dual labeling techniques before conducting functional assays

What are the emerging directions in Calcrl research and potential therapeutic applications?

Emerging research directions for Calcrl focus on its multifaceted roles in normal physiology and pathological conditions, with particular emphasis on its potential as a therapeutic target and biomarker:

  • Prognostic biomarker development:

    • CALCRL has demonstrated value as an independent prognostic factor in pediatric AML

    • Its expression is linked with relapse risk, supporting a role as a master regulator of relapse-initiating drug-tolerant cells

    • Further validation in larger patient cohorts could establish CALCRL as a standard prognostic marker for AML/ETO+ patients

  • Therapeutic targeting strategies:

    • The CALCRL/RAMP complex represents a potential therapeutic target, particularly in diseases with aberrant CGRP signaling

    • Development of selective antagonists or modulators of the Calcrl/RAMP1 complex could provide new treatment options for conditions ranging from migraine to cancer

    • Targeting downstream signaling pathways (PKA and ERK) activated by Calcrl may offer alternative therapeutic approaches

  • Molecular mechanisms in cancer biology:

    • Further exploration of how CALCRL contributes to drug resistance and colony formation in cancer cells

    • Investigation of CALCRL's role in stemness and how this may influence cancer progression and recurrence

    • Elucidation of cross-talk between CALCRL signaling and other oncogenic pathways

  • Structural biology advancements:

    • Cryo-EM and crystallography studies of the Calcrl/RAMP complex to inform structure-based drug design

    • Investigation of conformational changes induced by different ligands and their effects on signaling bias

    • Exploration of allosteric modulation sites that could be targeted therapeutically

  • Tissue-specific signaling dynamics:

    • Continued mapping of CALCRL expression patterns across diverse tissues

    • Investigation of tissue-specific signaling outcomes and their physiological significance

    • Development of tissue-targeted therapeutic approaches based on local expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.