Recombinant Mouse Calcium-binding mitochondrial carrier protein Aralar1 (Slc25a12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Slc25a12; Aralar1; Calcium-binding mitochondrial carrier protein Aralar1; Mitochondrial aspartate glutamate carrier 1; Solute carrier family 25 member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-677
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a12
Target Protein Sequence
MAVKVHTTKRGDPHELRNIFLQYASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLL AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII HHHIPFNWDCEFIRLHFGHNRKKHLNYVEFTQFLQELQLEHARQAFALKDKSKSGMISGL DFSDVMVTIRSHMLTPFVEENLVSAAGGGTSHQVSFSYFNAFNSLLNNMELVRKIYSTLA GTRKDIEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGT GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTKR DGSIPLPAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLQDLGLFGL YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGRVGGINLLTAGALAGVPAASLVTPAD VIKTRLQVAARAGQTTYSGVVDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL LQRWFYIDFGGLKPSGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF KSPSVAVAQPKAAAAAQ
Uniprot No.

Target Background

Function
Aralar1 (SLC25A12) is a mitochondrial and calcium-binding carrier protein. It catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. Aralar1 is believed to play a role in the urea cycle.
Gene References Into Functions
  1. Muller glia, due to their unique metabolic adaptations, utilize lactate and aspartate from neurons as substitutes for their missing PK and AGC1. PMID: 25313047
  2. Aralar protein and mRNA expressions were consistent in adult neurons and astrocytes, whole brain, and well-differentiated astrocyte cultures. However, this consistency emerged only during late development, coinciding with the brain's ability to synthesize and degrade glutamate. PMID: 23017600
  3. Postnatal Aralar-knockout mice exhibit hyperactivity, anxiety-like behavior, and hyperreactivity, accompanied by a decrease in dopamine (DA) in terminal-rich regions. PMID: 23216354
  4. Postnatal Electrophysiological Development Is Arrested in Aralar-Knockout Mice. PMID: 21934695
  5. The primary defect in pyramidal neurons of the cerebral cortex is possibly linked to a progressive failure in glutamatergic neurotransmission, potentially contributing significantly to the pathology of Aralar/AGC1 deficiency. PMID: 21608011
  6. Aralar1 was distinctly separated, unambiguously identified, and characterized from protein extracts of mouse hippocampus using multidimensional gel electrophoresis. PMID: 20506418
  7. Slc25a12-knockout mice, which lacked AGC1 expression as confirmed by immunoblotting, displayed delayed development and mortality around 3 weeks after birth. In postnatal day 13 to 14 knockout brains, the brains were smaller without any apparent gross structural alterations. PMID: 20015484
  8. Expression of the aspartate/glutamate mitochondrial carriers Aralar1 and citrin during development PMID: 12084073
  9. These findings indicate that Aralar plays a significant role in myelin formation by supplying aspartate for the synthesis of N-acetylaspartate in neuronal cells. PMID: 15987682
  10. Aralar has a crucial role in transducing small Ca2+ signals to neuronal mitochondria. PMID: 16269409
  11. Aralar and citrin, when expressed as single isoforms in the heart, exhibit differences in Ca(2+) activation of shuttle activity, likely attributed to their structural variations. PMID: 17213189
  12. A potential role for Aralar and MAS in priming beta-cells through Ca2+-mobilizing neurotransmitters or hormones. PMID: 18996845

Show More

Hide All

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Aralar1 and what is its primary function in cellular metabolism?

Aralar1 is a calcium-binding mitochondrial carrier protein that functions as an aspartate/glutamate carrier (AGC1). It serves as a key component of the malate-aspartate NADH shuttle system, which is crucial for supporting oxidative phosphorylation and ATP production . The protein contains EF-hand Ca²⁺-binding motifs in its N-terminal domain, making it responsive to calcium signaling . Functionally, Aralar1 facilitates the exchange of aspartate and glutamate across the inner mitochondrial membrane, thereby maintaining the NADH/NAD+ balance between cytosolic and mitochondrial compartments. This shuttle mechanism is particularly important in tissues with high energy demands, such as the brain, where it supports neuronal energy metabolism and various developmental processes .

How does Aralar1 contribute to neuronal metabolism specifically?

In neurons, the Aralar1-MAS pathway serves several critical metabolic functions. Research with Aralar-knockout mouse models has revealed that Aralar1 is essential for neuronal synthesis of aspartate (Asp) and N-acetylaspartate (NAA) . Additionally, Aralar1 plays a crucial role in enabling neurons to utilize lactate as a metabolic fuel . Studies have demonstrated that basal respiration on glucose is reduced in Aralar-knockout neurons, and the transmission of small Ca²⁺ signals to neuronal mitochondria is drastically impaired . These findings suggest that Aralar1 is integral to neuronal energy metabolism and mitochondrial calcium sensing. The protein appears to be expressed predominantly, if not exclusively, in neurons rather than in glial cells, though its expression pattern and functional relevance in astrocytes and oligodendrocytes remains somewhat controversial .

What experimental approaches have been most effective in characterizing Aralar1 at the protein level?

High-resolution characterization of Aralar1 has been achieved through multi-dimensional analytical approaches. Researchers have successfully employed sucrose gradient ultracentrifugation to enrich native membrane protein fractions, followed by blue-native PAGE and multidimensional gel electrophoresis . For comprehensive protein sequence coverage, in-gel digestion with multiple proteases (trypsin, chymotrypsin, and subtilisin) followed by nano-ESI-LC-MS/MS analysis using both collision-induced dissociation and electron transfer dissociation modes has proven effective . This combined approach has yielded impressive sequence coverage of 99.85% for Aralar1 extracted from mouse hippocampus . Such comprehensive protein characterization enables researchers to better predict protein conformation, identify splice variants, determine binding partners, and generate specific antibodies for further studies.

How do Slc25a12-knockout mouse models help us understand Aralar1 function in development?

Slc25a12-knockout mice provide valuable insights into the developmental roles of Aralar1. These mice are born with apparently normal Mendelian frequencies but display delayed development and typically die around 3 weeks after birth . At P13-14, knockout mouse brains are smaller than wild-type counterparts, suggesting global neurodevelopmental delay, although gross brain structure remains largely intact . Biochemical analysis confirms the absence of AGC1 protein by immunoblotting in homozygous knockout mice, while heterozygous mice show approximately half the AGC1 levels found in wild-type animals . Functionally, mitochondrial fractions prepared from P10 knockout brains show very low malate-aspartate shuttle activity (1.4±0.1 versus 14±0.1 absorbance change/min/g in wild type), confirming the functional disruption of this pathway . These characteristics establish Slc25a12-knockout mice as an excellent model for studying the role of Aralar1 in neurodevelopment.

What are the major neuropathological findings in Aralar1-deficient models?

Aralar1-deficient models demonstrate several significant neuropathological abnormalities. The most prominent finding is hypomyelination, characterized by a reduction in myelin basic protein (MBP)-positive fibers in multiple brain regions including the corpus callosum, anterior commissure, internal capsule, and habenulointerpedunclar tract . This myelin alteration is further confirmed by proteolipid protein (PLP) staining and quantitative immunoblotting, which shows MBP levels reduced to approximately 75% of wild-type levels in P10 knockout brains . Additionally, the neocortex of knockout mice contains abnormal neurofilamentous accumulations in neurons, suggesting defective axonal transport and/or neurodegeneration . These mice also exhibit epileptic activity in the hippocampus and dopamine mishandling in the nigrostriatal system . Interestingly, other neuronal and glial markers (GFAP, synaptophysin, and neurofilament) show no significant differences in expression levels between knockout and wild-type animals, indicating that the effects of Aralar1 deficiency are relatively specific .

What evidence links Aralar1 dysfunction to neurodevelopmental disorders such as autism spectrum disorders?

SLC25A12 has been identified as a susceptibility gene for autism spectrum disorders (ASDs), and mutations in this gene have been associated with a neurodevelopmental syndrome . The evidence connecting Aralar1 dysfunction to ASDs emerges from both genetic studies in humans and functional studies in animal models. Aralar1-knockout mice exhibit several neurological features that parallel aspects of ASDs, including developmental delay and abnormalities in brain structure . Research indicates that while complete loss of AGC1 leads to severe hypomyelination and neuronal changes, more subtle alterations in AGC1 expression could affect brain development in ways that contribute to increased autism susceptibility . The relationship between Aralar1 and ASDs likely involves the protein's role in energy metabolism, particularly since mitochondrial dysfunction has been increasingly recognized as a factor in the etiology of some forms of autism. These findings suggest that disturbances in the malate-aspartate shuttle system may represent one metabolic pathway through which neurodevelopmental disorders can arise.

What are the recommended protocols for generating and validating Slc25a12-knockout models?

For generating Slc25a12-knockout models, a targeted gene disruption approach has proven effective. The mouse Slc25a12 gene consists of 18 exons spread over approximately 100 kb of genomic DNA. Researchers have successfully modified mouse genomic DNA by replacing exon 1 with a neoIGFP cassette . This targeting construct is then introduced into embryonic stem (ES) cells (C57BL/6 background has been used), and targeted clones are selected to establish a mouse line carrying the disrupted allele . Validation of the knockout model should include:

  • Genotyping: PCR-based methods to confirm gene disruption

  • Protein expression analysis: Immunoblotting to verify the absence of AGC1 protein in homozygous knockouts and reduced levels in heterozygotes

  • Functional verification: Measurement of malate-aspartate shuttle activity in mitochondrial fractions using spectrophotometric assays

  • Phenotypic characterization: Assessment of developmental milestones, survival curves, and neurological examination

This comprehensive validation approach ensures that the observed phenotypes are indeed due to Aralar1 deficiency rather than off-target effects or genetic background influences.

What methods are most effective for studying myelination defects in Aralar1-deficient models?

Several complementary approaches have proven valuable for investigating myelination defects in Aralar1-deficient models:

  • Immunohistochemistry: Staining for myelin markers such as myelin basic protein (MBP) and proteolipid protein (PLP) in brain sections allows visualization and quantification of myelinated fibers

  • Quantitative immunoblotting: Analysis of myelin protein expression levels in brain extracts provides a quantitative measure of myelination status

  • Slice cultures: Cerebellar slice cultures prepared from P10 mice (both knockout and wild-type littermates) offer an ex vivo system for studying myelination processes and testing potential therapeutic interventions

  • Oligodendrocyte precursor cell (OPC) cultures: Primary OPCs can be nucleofected with Aralar1 constructs or siRNAs and then assessed for differentiation and myelin protein expression

  • Quantitative PCR: Measuring the mRNA levels of myelin genes (Cldn11, Cnp1, Mag, Mobp, Olig2, Plp1, Qk5/6, Sox10, and Erbb4) provides insight into transcriptional regulation of myelination

These methods should be applied in combination for a comprehensive understanding of how Aralar1 deficiency affects myelination at molecular, cellular, and tissue levels.

How can researchers measure malate-aspartate shuttle activity in experimental models?

Measurement of malate-aspartate shuttle (MAS) activity is crucial for assessing the functional consequences of Aralar1 manipulation. The recommended protocol involves:

  • Preparation of mitochondrial fractions: Isolate mitochondria from the tissue of interest (e.g., brain) using differential centrifugation

  • Spectrophotometric assay: MAS activity can be determined by measuring changes in absorbance that reflect the oxidation of NADH in a coupled enzyme system

  • Normalization: Activity should be expressed as absorbance change per minute per gram of tissue (e.g., absorbance change/min/g)

In Aralar1 studies, wild-type mouse brain typically exhibits MAS activity of approximately 14±0.1 absorbance change/min/g, while knockout brains show drastically reduced activity of about 1.4±0.1 absorbance change/min/g . This significant difference provides a reliable functional readout of Aralar1 deficiency. Additionally, researchers can complement direct MAS activity measurements with assessments of related metabolic parameters, such as NAD+/NADH ratios, ATP levels, and the concentrations of relevant metabolites like aspartate, glutamate, and N-acetylaspartate.

How does calcium regulation influence Aralar1 function and mitochondrial metabolism?

Aralar1 contains EF-hand Ca²⁺-binding motifs in its N-terminal domain, making it directly responsive to calcium signals . This calcium-binding property is physiologically significant as it allows Aralar1 to integrate calcium signaling with mitochondrial metabolism. Research indicates that calcium stimulates the aspartate/glutamate exchange activity of Aralar1, suggesting a mechanism by which cytosolic calcium signals can modulate mitochondrial functions . In neuronal contexts, this calcium sensitivity appears particularly important, as Aralar1-knockout neurons show drastic impairment in the transmission of small Ca²⁺ signals to mitochondria .

The calcium regulation of Aralar1 has several metabolic implications:

  • It provides a mechanism for coupling neuronal activity (which involves calcium signaling) to energy metabolism

  • It allows for rapid adjustment of malate-aspartate shuttle activity in response to changing cellular conditions

  • It may contribute to the compartmentalization of metabolic responses within different cellular microdomains

Researchers investigating this aspect of Aralar1 function should consider employing calcium imaging techniques alongside metabolic measurements to fully characterize the relationship between calcium dynamics and Aralar1-mediated metabolic processes.

What is the evidence for cell-type specific roles of Aralar1 in the brain?

  • Aralar1-knockout mice show failure of astrocytes to synthesize glutamine, suggesting that neuronal Aralar1 expression might be necessary for proper astrocytic function

  • Hypomyelination observed in knockout mice could indicate that neuronal Aralar1 is required for oligodendrocyte function and myelination

  • Reduction of Slc25a12 in rat primary oligodendrocytes leads to a cell-autonomous reduction in MBP expression, suggesting direct effects in oligodendrocytes

These observations raise the question of whether the glial phenotypes observed in Aralar1-deficient models are a direct consequence of Aralar1 deficiency in glial cells or an indirect effect of neuronal dysfunction. Further research using cell-type specific knockouts or conditional expression systems will be necessary to fully delineate the cell-autonomous versus non-autonomous effects of Aralar1 in different brain cell populations.

How does Aralar1 manipulation affect metabolic profiles in cellular and animal models?

Manipulation of Aralar1 expression leads to significant alterations in cellular and tissue metabolic profiles. In Aralar1-knockout mice, major metabolic changes include:

Conversely, Aralar1 overexpression in insulin-secreting cells has been shown to:

  • Increase glucose- and amino-acid-stimulated insulin secretion (both long-term 24h and acute 20min responses)

  • Enhance cellular glucose metabolism

  • Increase L-alanine and L-glutamine consumption

  • Elevate cellular ATP and glutamate concentrations

  • Reduce lactate production and cellular triacylglycerol and glycogen contents

These findings indicate that Aralar1 represents a key metabolic control site that can significantly shift cellular metabolism when its expression is altered. The table below summarizes some of the key metabolic changes observed with Aralar1 manipulation:

ParameterEffect of Aralar1 KnockoutEffect of Aralar1 Overexpression
Aspartate productionDecreasedNot reported
N-acetylaspartateDecreasedNot reported
Lactate metabolismImpaired utilizationReduced production (38%)
Glutamate levelsAlteredIncreased
ATP levelsLikely decreasedIncreased
Glucose metabolismDecreasedIncreased
Insulin secretionNot applicableIncreased (glucose- and amino-acid-stimulated)
MyelinationReducedNot reported

These metabolic alterations underscore the central role of Aralar1 in coordinating energy metabolism across different tissues and cell types.

What approaches have shown promise for treating pathologies associated with Aralar1 deficiency?

Several therapeutic approaches have shown promise in addressing the metabolic defects associated with Aralar1 deficiency:

  • Pyruvate administration: In slice cultures from Aralar1-knockout mice, administration of pyruvate has successfully reversed myelin deficits . This suggests that bypassing the need for the malate-aspartate shuttle by providing alternative substrates can ameliorate some of the consequences of Aralar1 deficiency.

  • Metabolic substrate supplementation: Since Aralar1 deficiency leads to specific metabolic defects, such as reduced aspartate and NAA production, providing relevant metabolic intermediates might help mitigate symptoms.

  • Targeting downstream pathways: Addressing specific consequences of Aralar1 deficiency, such as using anti-epileptic drugs for seizure control or dopaminergic agents for dopamine mishandling.

What are the key methodological considerations for studying Aralar1 in the context of insulin secretion?

When investigating Aralar1 in insulin-secreting cells, several methodological considerations are important:

  • Selection of appropriate cell models: The BRIN-BD11 clonal insulin-secreting cell line has been successfully used to study Aralar1 effects on insulin secretion . These cells respond to both glucose and amino acids, making them suitable for comprehensive studies of Aralar1 function.

  • Aralar1 overexpression techniques: Recombinant adenovirus (AdCA-Aralar1) has been effective for transducing insulin-secreting cells and achieving Aralar1 overexpression .

  • Comprehensive metabolic profiling: Studies should measure multiple parameters including:

    • Insulin secretion (both long-term 24h and acute 20min responses)

    • Cellular glucose metabolism

    • Amino acid consumption (particularly L-alanine and L-glutamine)

    • ATP and glutamate concentrations

    • Cellular triacylglycerol and glycogen contents

    • Lactate production

  • Stimulus-secretion coupling analysis: Investigating how Aralar1 affects the coupling between metabolic stimuli and insulin granule exocytosis provides insight into the mechanisms by which Aralar1 influences insulin secretion.

Research has shown that Aralar1 overexpression potentiates glucose-induced L-glutamate release by 13% while reducing L-lactate release by 38% in insulin-secreting cells . These findings indicate that Aralar1 is a key metabolic control site in these cells, and its manipulation can positively shift β-cell metabolism, thereby increasing glycolysis capacity, stimulus-secretion coupling, and ultimately enhancing insulin secretion.

What are the most promising future research directions for Aralar1 studies?

Several exciting research directions hold promise for advancing our understanding of Aralar1 biology and its implications:

  • Cell-type specific functions: Clarifying whether the glial phenotypes observed in Aralar1-deficient models are a direct consequence of Aralar1 deficiency in glial cells or an indirect effect of neuronal dysfunction . This could be addressed using cell-type specific knockout or conditional expression systems.

  • Transcellular metabolic fluxes: Further delineating the metabolic interactions between neurons, astrocytes, and oligodendrocytes that are regulated by Aralar1 activity . This includes better understanding of the glutamate-glutamine cycle and metabolite trafficking between brain cell types.

  • Calcium signaling integration: Exploring how the calcium-binding properties of Aralar1 integrate calcium signaling with mitochondrial metabolism in different physiological contexts.

  • Therapeutic development: Building on successful approaches like pyruvate supplementation to develop more targeted and effective treatments for Aralar1-associated disorders.

  • Connection to neurodevelopmental disorders: Investigating how subtle alterations in Aralar1 expression might contribute to conditions like autism spectrum disorders , potentially leading to novel diagnostic or therapeutic approaches.

  • Metabolic imaging: Developing and applying advanced metabolic imaging techniques to visualize Aralar1-dependent metabolic fluxes in live cells and tissues.

These research directions will not only advance our fundamental understanding of Aralar1 biology but may also lead to important clinical applications for neurodevelopmental, metabolic, and possibly neurodegenerative disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.