Recombinant Mouse Calcium-binding mitochondrial carrier protein Aralar2 (Slc25a13)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Function

Aralar2 (Slc25a13) is a multi-pass transmembrane protein localized to the mitochondrial inner membrane. It facilitates the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate, a process integral to the malate-aspartate shuttle and cellular energy metabolism . This activity supports ATP biosynthesis, gluconeogenesis, and urea cycle function .

PropertyDetail
Gene SymbolSlc25a13 (mouse)
Protein NameCalcium-binding mitochondrial carrier protein Aralar2
Molecular Weight~74.4 kDa (isoform 2)
Subcellular LocationMitochondrial inner membrane
Key DomainsFour N-terminal EF-hand Ca²⁺-binding motifs

Production Methods and Characteristics

Recombinant Aralar2 is synthesized using heterologous expression systems, including:

Host SystemPurityApplicationsSource
E. coli>95%ELISA controls, Western Blotting
Cell-free expression≥85%Structural studies, antigen production
Insect/mammalian cells≥85%Functional assays, post-translational modifications

Key Features:

  • Host Flexibility: Host selection determines post-translational modifications (e.g., glycosylation in mammalian systems) .

  • Purity: SDS-PAGE confirms ≥85% purity for most preparations .

  • Isoforms: Mouse Aralar2 exists as isoform 2 (74.4 kDa) and isoform 1, differing in alternative splicing .

Research Applications

Recombinant Aralar2 serves as a critical tool in studying mitochondrial metabolism and disease mechanisms:

ApplicationMethodPurposeSource
ELISASandwich immunoassayQuantify Aralar2 levels in mouse samples
Western BlottingRabbit polyclonal antibodiesDetect protein expression in tissues
Functional AssaysTransport studies in vitroAnalyze substrate specificity and kinetics

Example Protocol:

  1. ELISA Detection:

    • Sample Preparation: Serum/plasma diluted in sample diluent.

    • Detection Range: 0.312–20 ng/mL (sensitivity: 0.157 ng/mL) .

Disease Associations

Aralar2 dysfunction is linked to severe metabolic disorders:

DiseaseSymptomsGenetic BasisSource
Citrullinemia Type 2Hyperammonemia, seizures, coma (adult-onset)SLC25A13 mutations (e.g., p.R382Q)
NICCDNeonatal cholestasis, hypoproteinemiaSLC25A13 loss-of-function alleles

Mechanistic Insight:

  • Urea Cycle Defect: Impaired glutamate/aspartate shuttle disrupts nitrogen disposal .

  • Neurological Impact: Ammonia toxicity in CTLN2 causes brain edema and neuropsychiatric symptoms .

Regulatory and Handling Considerations

  • Storage: Lyophilized components stored at -20°C; others at 4°C .

  • Usage: For research purposes only; not intended for therapeutic use .

  • Ethical Compliance: Adhere to institutional guidelines for animal/human sample handling.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Slc25a13; Aralar2; Calcium-binding mitochondrial carrier protein Aralar2; Citrin; Mitochondrial aspartate glutamate carrier 2; Solute carrier family 25 member 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-676
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a13
Target Protein Sequence
MAAAKVALTKRADPAELKAIFLKYASIEKNGEFFMSPHDFVTRYLNIFGESQPNPKTVEL LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQIFGQTT IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNAKTGKVSA IDFRDIMVTIRPHVLTPFVEECLVAAAGGTRSHQVSFSYFNGFNSLLNNMELIRKIYSTL AGNRKDVEVTKEEFALAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGM LPFNLAEAQRQQKASGDAARPFLLQLAESAYRFGLGSIAGAVGATAVYPIDLVKTRMQNQ RSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKF MHKDGSVPLLAEIFAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGF FGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVT PADVIKTRLQVAARAGQTTYNGVTDCFRKILREEGPKALWKGVAARVFRSSPQFGVTLLT YELLQRWFYVDFGGVKPVGSEPVPKSRITLPAPNPDHVGGYKLAVATFAGIENKFGLYLP LFKPSASTSKVTAGDS
Uniprot No.

Target Background

Function
Aralar2 (SLC25A13) is a mitochondrial and calcium-binding carrier protein. It catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the inner mitochondrial membrane. It may also play a role in the urea cycle.
Gene References Into Functions
  • Hepatic metabolite perturbations in citrin-mitochondrial glycerol-3-phosphate dehydrogenase double-knockout mice, a model of human citrin deficiency. PMID: 21908222
  • Glial cells exhibit significantly lower AGC levels and MAS activity compared to neurons. PMID: 19908284
  • Expression of the aspartate/glutamate mitochondrial carriers aralar1 and citrin during development. PMID: 12084073
  • Investigation of the physiological role of citrin and the development of CTLN2 (adult-onset type II citrullinemia) using an Slc25a13-knockout mouse model. PMID: 14701727
  • Aralar and citrin, expressed as single isoforms in the heart, show differences in Ca(2+) activation of shuttle activity, likely due to structural variations. PMID: 17213189
  • Phenotypic analysis of citrin/mitochondrial glycerol-3-phosphate dehydrogenase double knock-out mice. PMID: 17591776
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
At E10.5, expressed in branchial arches, a well as in the limb and tail buds. At E13.5 expression is predominant in epithelial structures and the forebrain, kidney and liver. Expression in liver is maintained into adulthood.

Q&A

What is the basic function of Aralar2/SLC25A13 in cellular metabolism?

Aralar2/SLC25A13 functions as a calcium-binding mitochondrial carrier protein that plays a crucial role in cellular metabolism. It specifically catalyzes the exchange of aspartate for glutamate and a proton across the inner mitochondrial membrane . This transport activity is essential for the functioning of the malate-aspartate shuttle (MAS), a biochemical system that transfers reducing equivalents from the cytosol to the mitochondria .

The protein's activity is notably stimulated by calcium on the external side of the inner mitochondrial membrane . This calcium sensitivity creates a crucial link between cytosolic calcium concentration and mitochondrial energy metabolism, allowing cells to adjust their metabolic activity in response to calcium-dependent signaling events . Through this mechanism, Aralar2 helps coordinate cellular calcium signaling with energy production pathways.

Dysfunction of Aralar2 has been associated with various pathological conditions, including neurological disorders and metabolic abnormalities . This emphasizes its importance in maintaining normal cellular function and energy homeostasis across different tissues.

How is the structure of Aralar2 organized to support its function?

Aralar2 possesses a complex three-domain structure that enables its dual functionality in calcium sensing and metabolite transport. The protein consists of:

  • An N-terminal domain with eight predicted EF-hand motifs (approximately residues 1-319, 36 kDa) that protrudes into the intermembrane space

  • A carrier domain (approximately residues 320-612, 32 kDa) that is responsible for the transport activity

  • A C-terminal domain (approximately residues 613-675, 6 kDa)

The N-terminal domain contains calcium-binding EF-hand motifs that act as calcium sensors, while the carrier domain shares 20-30% sequence identity with other mitochondrial carrier family members and is responsible for the actual transport activity . Proteolysis experiments with proteinase K have confirmed that the N-terminal domain protrudes into the intermembrane space, positioning it to bind extra-mitochondrial calcium .

A notable structural feature is the "linker loop" (residues 296-308) that connects the N-terminal domain to the carrier domain . This linker undergoes conformational changes in response to calcium binding, suggesting it plays a crucial role in transmitting calcium-binding signals to the carrier domain to regulate transport activity.

What techniques are recommended for detecting and quantifying Aralar2 in experimental samples?

For researchers working with Aralar2, several validated techniques exist for its detection and quantification:

ELISA Assays:
ELISA kits specifically designed for Aralar2/SLC25A13 offer high sensitivity and specificity. These sandwich ELISA systems can detect Aralar2 in various sample types including serum, plasma, and cell culture supernatants . Typical detection ranges are between 0.312-20 ng/mL with a sensitivity of approximately 0.12 ng/mL . This approach is particularly valuable for quantitative measurements across multiple samples.

Western Blotting:
Western blot analysis remains a standard approach for Aralar2 detection and semi-quantification. This technique allows researchers to confirm protein size and assess relative abundance in different samples . When performing Western blots for Aralar2, appropriate controls should be included to verify antibody specificity.

Fluorescence-Based Techniques:
For localization studies, immunofluorescence microscopy using specific anti-Aralar2 antibodies can determine subcellular distribution, particularly its mitochondrial localization. This can be combined with mitochondrial markers for co-localization studies.

Mass Spectrometry:
For detailed proteomic analysis, mass spectrometry techniques allow for identification of post-translational modifications and protein-protein interactions involving Aralar2. This approach requires specialized equipment but provides comprehensive structural information.

When selecting a detection method, researchers should consider their specific experimental needs, required sensitivity, and available equipment. For quantitative work, ELISA offers the most precise measurements, while Western blotting provides information about protein integrity and relative abundance.

How do calcium-induced conformational changes regulate Aralar2 transport activity?

Calcium binding to the regulatory domain of Aralar2 triggers significant conformational changes that modulate its transport activity. Research has demonstrated that this regulation involves multiple structural elements working in concert:

The calcium sensing mechanism operates through the N-terminal domain of Aralar2, which contains eight predicted EF-hand motifs . Upon calcium binding to these motifs, the protein undergoes conformational changes that are transmitted to the carrier domain, leading to stimulation of transport activity. This calcium-dependent regulation allows the malate-aspartate shuttle to respond to changes in cytosolic calcium concentration .

The interactions between the linker loop and the rest of the N-terminal domain involve both hydrophobic contacts and hydrogen bonds, primarily mediated by backbone amide-backbone carbonyl interactions between specific residues . This network of interactions is disrupted upon calcium binding, facilitating the conformational change necessary for activation.

Importantly, this calcium-dependent regulation mechanism provides a direct link between cellular calcium signaling and mitochondrial energy metabolism, allowing cells to adjust their metabolic activity in response to calcium-dependent signaling events.

What mechanisms underlie Aralar2's role in maintaining mitochondrial membrane potential and ATP production?

Aralar2 plays a critical role in maintaining mitochondrial membrane potential (Δψm) and ATP production through several interconnected mechanisms:

Malate-Aspartate Shuttle Regulation:
As a component of the malate-aspartate shuttle (MAS), Aralar2 facilitates the transfer of reducing equivalents (NADH) from the cytosol to the mitochondria . This process is essential for maintaining the NAD+/NADH ratio in both compartments and supporting continued glycolysis and oxidative phosphorylation.

Experimental Evidence of Impact:
Research using Aralar siRNA knockdown in cellular models has provided direct evidence of Aralar2's importance in these processes. When Aralar levels were decreased:

These findings demonstrate that Aralar2 is not merely a passive transporter but plays an active role in maintaining mitochondrial function and cellular energy homeostasis.

Calcium-Energy Metabolism Coupling:
Aralar2's calcium sensitivity allows it to couple cytosolic calcium signaling with mitochondrial energy production. When cytosolic calcium increases, Aralar2 activity is enhanced, boosting the malate-aspartate shuttle and subsequently NADH transport into mitochondria . This mechanism ensures that energy production can be rapidly increased in response to cellular calcium signaling events, which often indicate increased energy demands.

The experimental evidence strongly suggests that Aralar2's role extends beyond simple metabolite transport to include a fundamental role in maintaining mitochondrial integrity and function, making it essential for cell survival.

What is the significance of Aralar2 dimerization and how does it impact function?

Aralar2 dimerization represents a critical structural feature that influences its transport and regulatory capabilities. Multiple lines of experimental evidence confirm this dimeric arrangement:

Structural Analysis:
Size-exclusion chromatography coupled to multi-angle laser light scattering (SEC-MALLS) has revealed that full-length Aralar2/citrin exists as a dimer with a measured mass of approximately 147.7±1.7 kDa, twice the theoretical monomer mass of 74 kDa . Similar dimeric arrangements have been observed for the N- and C-terminal domain fusions of both citrin and aralar, with masses of 80.9±0.8 kDa and 82.0±0.9 kDa respectively, each approximately twice their theoretical monomer masses .

Dimerization Mechanism:
The N-terminal domains specifically mediate the dimerization of the full-length aspartate/glutamate carriers. Even when expressed alone, the N-terminal domain of aralar forms a dimer with a mass of 65.3±0.3 kDa . This suggests that dimerization is an intrinsic property of the N-terminal regulatory domain rather than the carrier domain.

Functional Implications:
The dimeric arrangement of Aralar2 has several functional consequences:

  • Increased regulatory sensitivity: The presence of multiple calcium-binding sites across two protomers may allow for more nuanced regulation of transport activity in response to changing calcium concentrations.

  • Cooperative binding: Dimerization may enable cooperative calcium binding, where binding of calcium to one protomer influences binding to the second protomer.

  • Enhanced structural stability: The dimeric structure likely provides greater stability to the protein complex in the mitochondrial membrane.

  • Coordinated transport: Dimerization may allow for coordinated transport activity between the two carrier domains, potentially enhancing transport efficiency.

This dimeric arrangement distinguishes Aralar2 from many other mitochondrial carriers and may contribute to its specialized function in linking calcium signaling to metabolite transport and energy metabolism.

How can researchers effectively use siRNA or CRISPR to study Aralar2 function in cellular models?

Genetic manipulation approaches offer powerful tools for studying Aralar2 function in cellular contexts. Both siRNA and CRISPR-Cas9 techniques have specific advantages depending on research goals:

siRNA Approach:

siRNA provides a straightforward method for temporary knockdown of Aralar2 expression:

  • Design Considerations:

    • Target unique regions of the Aralar2 mRNA not shared with other family members

    • Design multiple siRNAs (at least 3-4) targeting different regions to confirm specificity

    • Include scrambled siRNA controls with similar GC content

  • Optimization Protocol:

    • Test transfection efficiency using fluorescently labeled control siRNAs

    • Determine optimal siRNA concentration (typically 10-50 nM) to minimize off-target effects

    • Assess knockdown efficiency by Western blot at 24, 48, and 72 hours post-transfection

  • Validation Requirements:

    • Confirm specific reduction of Aralar2 protein by Western blot (>70% reduction is desirable)

    • Verify that related proteins (e.g., other mitochondrial carriers) remain unaffected

    • Include rescue experiments with siRNA-resistant Aralar2 constructs to confirm specificity

Published research has successfully used Aralar siRNA to achieve significant knockdown in BV2 microglial cells, reducing protein levels sufficiently to observe phenotypic changes in cell survival and mitochondrial function .

CRISPR-Cas9 Approach:

For stable knockout or precise gene editing:

  • Guide RNA Design:

    • Target early exons to ensure complete loss of function

    • Use multiple bioinformatic tools to identify guides with high on-target and low off-target scores

    • Consider using paired nickase approaches for higher specificity

  • Verification Steps:

    • Confirm editing by sequencing the targeted genomic region

    • Verify protein loss by Western blot

    • Perform off-target analysis at predicted sites

  • Phenotypic Analysis:

    • Assess mitochondrial membrane potential using JC-1 assays

    • Measure intracellular ATP levels using luminescence-based assays

    • Evaluate cell survival and apoptosis using Annexin V/7-AAD assays

    • Analyze mitochondrial calcium uptake and respiratory capacity

For both approaches, it's crucial to include appropriate controls and to validate findings using multiple cell lines or primary cells when possible. The choice between transient (siRNA) and permanent (CRISPR) manipulation should be guided by specific experimental requirements and the cellular model being used.

What protocols are recommended for investigating calcium-dependent regulation of Aralar2?

Studying the calcium-dependent regulation of Aralar2 requires specialized experimental approaches that can detect both structural changes and functional responses. The following protocols provide comprehensive methodologies:

Measuring Calcium-Dependent Transport Activity:

  • Reconstituted Liposome Assays:

    • Prepare liposomes containing purified recombinant Aralar2

    • Set up transport reactions in buffers with defined free calcium concentrations (typically ranging from <10 nM to >10 μM)

    • Use calcium chelators (EGTA/BAPTA) for low calcium conditions and calcium-EGTA buffers for defined free calcium concentrations

    • Measure substrate exchange rates using radioisotope-labeled aspartate or glutamate

    • Calculate transport activity as a function of calcium concentration to determine EC50 values

  • Mitochondrial Preparations:

    • Isolate intact mitochondria or prepare mitoplasts (mitochondria with disrupted outer membranes)

    • Measure transport activity in the presence of varying calcium concentrations

    • Assess calcium effects on malate-aspartate shuttle activity by measuring NADH transfer from cytosol to mitochondria

Detecting Calcium-Induced Conformational Changes:

  • Structural Analysis Techniques:

    • Employ fluorescence spectroscopy to monitor intrinsic tryptophan fluorescence changes upon calcium binding

    • Use circular dichroism to detect secondary structure alterations

    • For detailed structural information, implement hydrogen-deuterium exchange mass spectrometry to map regions undergoing conformational changes

  • Calcium Binding Assays:

    • Perform isothermal titration calorimetry (ITC) with purified protein to determine binding constants and thermodynamic parameters

    • Use ⁴⁵Ca²⁺-overlay experiments as described in previous studies

    • For EF-hand mutants, compare calcium binding properties with wild-type protein to identify critical binding sites

Cellular Models for Calcium Regulation:

  • Live-Cell Imaging:

    • Engineer cells expressing fluorescent calcium indicators (GCaMP) targeted to mitochondria or cytosol

    • Simultaneously monitor calcium levels and metabolic parameters (e.g., NADH autofluorescence, mitochondrial membrane potential)

    • Stimulate cells to elevate cytosolic calcium while measuring metabolic responses

    • Compare responses in cells with normal versus reduced Aralar2 levels

  • Calcium Perturbation Experiments:

    • Use calcium ionophores (ionomycin) or store-operated calcium entry activators to elevate cytosolic calcium

    • Apply calcium chelators (BAPTA-AM) to reduce cytosolic calcium

    • Measure metabolic consequences using respirometry, ATP assays, or malate-aspartate shuttle activity measurements

These protocols provide comprehensive approaches to investigate how calcium regulates Aralar2 at structural and functional levels across different experimental systems.

What are the current knowledge gaps and future research directions for Aralar2?

Despite significant advances in understanding Aralar2 structure and function, several critical knowledge gaps remain that represent promising directions for future research:

Structural-Functional Relationships:
While we know that calcium binding induces conformational changes in Aralar2, the precise molecular mechanisms by which these changes modulate transport activity remain incompletely understood . Future research should focus on obtaining high-resolution structures of the full-length protein in both calcium-bound and calcium-free states, potentially using cryo-electron microscopy.

Tissue-Specific Functions:
The role of Aralar2 has been studied primarily in neurons and some cellular models like BV2 microglia , but its importance in other tissues with high energy demands (heart, muscle, kidney) requires further investigation. Tissue-specific knockout models could provide valuable insights into these varied roles.

Pathological Implications:
While dysfunction of Aralar2 has been associated with neurological disorders and metabolic abnormalities , the specific mechanisms through which Aralar2 dysfunction contributes to disease pathology need clarification. Investigating Aralar2 in disease models and patient samples represents an important research direction.

Regulatory Network:
How Aralar2 interacts with other components of cellular energy metabolism beyond the malate-aspartate shuttle remains an open question. Comprehensive proteomic and interactome studies could reveal novel protein-protein interactions and regulatory mechanisms.

Therapeutic Potential:
Given its critical role in cell survival and energy metabolism , Aralar2 represents a potential therapeutic target. Developing specific modulators of Aralar2 activity and testing their effects in disease models would be valuable for assessing this potential.

Methodological Advances:
Development of improved tools for studying Aralar2 in live cells, such as specific inhibitors or activity-sensing probes, would facilitate more dynamic studies of its function in intact cellular systems.

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, and systems biology. The critical importance of Aralar2 in linking calcium signaling to energy metabolism makes it a fascinating target for continued research with potential implications for understanding and treating various diseases.

How can researchers integrate Aralar2 studies with broader mitochondrial research?

Integrating Aralar2 research within the broader context of mitochondrial biology offers valuable opportunities for comprehensive understanding of energy metabolism and cellular homeostasis:

Mitochondrial Dynamics:
Future studies should investigate how Aralar2 function relates to mitochondrial dynamics (fission, fusion, mitophagy). Since Aralar2 knockdown leads to mitochondrial depolarization , exploring whether this affects mitochondrial network morphology and quality control mechanisms would provide valuable insights into mitochondrial health regulation.

Calcium Signaling Integration:
Given Aralar2's calcium sensitivity , examining how it participates in the broader calcium signaling network between cytosol, mitochondria, and endoplasmic reticulum represents an important research direction. This includes investigating how Aralar2 coordinates with mitochondrial calcium uniporters and calcium exchangers.

Bioenergetic Studies:
Researchers should integrate Aralar2 studies with comprehensive bioenergetic analyses using techniques such as:

  • Seahorse extracellular flux analysis to measure oxygen consumption rate and extracellular acidification rate

  • High-resolution respirometry to assess different respiratory states

  • In vivo NMR spectroscopy to track metabolite fluxes in intact tissues

Disease Models:
When studying diseases with mitochondrial dysfunction components (neurodegenerative diseases, metabolic disorders), researchers should include Aralar2 assessment alongside other mitochondrial parameters. This integrated approach may reveal previously unrecognized connections between specific mitochondrial functions and disease mechanisms.

Inter-organelle Communication: Investigating how Aralar2-mediated processes coordinate with other organelles beyond mitochondria will provide a more holistic understanding of cellular metabolism. This includes examining mitochondria-ER contact sites and how they influence Aralar2 function through calcium microdomains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.