Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-1 (Slc25a24)

Shipped with Ice Packs
In Stock

Description

Introduction to SCaMC-1 (Slc25a24)

SCaMC-1 (Small Calcium-binding Mitochondrial Carrier 1), also known as SLC25A24, is a calcium-dependent mitochondrial carrier protein. The recombinant mouse variant is produced to study its structural and functional roles in mitochondrial physiology. It facilitates ATP-Mg<sup>2-</sup>/Pi<sup>2-</sup> and ADP<sup>3-</sup>/Pi<sup>2-</sup> exchange across the mitochondrial inner membrane, influencing cellular energy homeostasis and stress responses .

Functional Role

SCaMC-1 regulates mitochondrial matrix adenine nucleotide pools and calcium buffering:

  • ATP-Mg/Pi Transport: Mediates electroneutral exchange of ATP-Mg or ADP for phosphate, adapting mitochondrial function to cellular energy demands .

  • Calcium Buffering: Enhances mitochondrial calcium retention capacity (CRC) by forming calcium-phosphate precipitates, desensitizing cells to mitochondrial permeability transition (mPT)-driven necrosis .

  • Disease Relevance: Overexpression in cancer cells promotes resistance to oxidative stress-induced cell death .

Recombinant Production

Recombinant mouse SCaMC-1 is synthesized using heterologous expression systems for biochemical and functional studies:

Research Applications

  • Mechanistic Studies: Used to elucidate the "locking pin" regulatory mechanism, where calcium binding releases the amphipathic α-helix to activate transport .

  • Cancer Biology: Knockdown models demonstrate increased susceptibility to oxidative stress and calcium overload, validating its role in tumor cell survival .

  • Technical Assays: Applied in Western blotting, ELISA, and functional transport assays using proteoliposomes .

Technical Notes

  • Stability: The carrier domain has a melting temperature (T<sub>m</sub>) of 56.7°C in calcium-bound states, decreasing to 47.5°C in calcium-free conditions .

  • Activity: Truncation mutants lacking the regulatory domain (e.g., Δ1-155) retain partial transport activity but lose calcium sensitivity .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate your preference when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a24; Scamc1; Calcium-binding mitochondrial carrier protein SCaMC-1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-475
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a24
Target Protein Sequence
MLRWLRAFVLPTAACHDAEPPTRYETLFRALDRNGDGVVDIGELQQGLQSLGIPLGQDAE EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEPSEIVQSLQMLGL HISEKQAELILQSIDSDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI PDEFTEDEKKSGQWWRQLLAGGVAGAVSRTSTAPLDRLKVMMQVHGSKSMNIFGGFRQMV KEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKLGTFERFISGSMAGATA QTFIYPMEVLKTRLAVAKTGQYSGIYGCAKKILKHEGFGAFYKGYIPNLLGIIPYAGIDL AVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQATVEGA PQLSMVGLFQRIVSKEGVSGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVAQK
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. This protein mediates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP against phosphate ions, facilitating the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive when cytosolic calcium levels are low and is activated by an increase in cytosolic calcium levels. This protein may play a role in protecting cells against oxidative stress-induced cell death. This is likely achieved by promoting the formation of calcium-phosphate precipitates in the mitochondrial matrix, thereby buffering calcium levels within the mitochondrial matrix.
Gene References Into Functions
  1. Genetic analyses in human and mouse models have highlighted the importance of SLC25A24/Slc25a24 in regulating body fat mass and adipogenesis. PMID: 25599384
  2. SCaMC-1 exerts a negative feedback control between cellular Ca(2+) overload and mPT-dependent cell death, suggesting that the carrier might be a novel target for cancer therapy. PMID: 22015608
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and primary function of SCaMC-1 protein?

SCaMC-1 (SLC25A24) belongs to the mitochondrial carrier family and functions as a calcium-sensitive adenine nucleotide transporter. Structurally, SCaMC-1 consists of two distinct domains: a C-terminal domain comprising six transmembrane helices homologous to mitochondrial carrier proteins, and an N-terminal domain with calcium-binding EF hands . This structural arrangement allows SCaMC-1 to function as a Ca²⁺-regulated transporter.

The primary function of SCaMC-1 is to mediate the transport of ATP-Mg²⁻/Pi²⁻ and/or HADP²⁻/Pi²⁻ across the mitochondrial inner membrane in response to increased cytosolic calcium concentrations . This transport activity contributes significantly to calcium buffering within the mitochondrial matrix, which ultimately results in desensitization of the mitochondrial permeability transition (mPT) . The protein's activity represents an important regulatory mechanism in cellular energy metabolism and calcium homeostasis, particularly under stress conditions.

Researchers studying SCaMC-1 should note that the protein's transmembrane organization follows the typical pattern of mitochondrial carriers, with matrix loops connecting the transmembrane helices and specific residues in helices H2, H4, and H6 participating in substrate interactions .

How does SCaMC-1 expression differ between normal and cancer cells?

Comprehensive gene expression analysis has demonstrated that SCaMC-1 overexpression is a general feature of transformed and cancer cells . This differential expression pattern makes SCaMC-1 particularly interesting from both biological and therapeutic perspectives.

The overexpression of SCaMC-1 in cancer cells appears to serve a protective function against cellular stress. Studies have shown that high levels of SCaMC-1 confer resistance specifically to mitochondrial permeability transition (mPT)-dependent cell death . This protective effect is consistent with SCaMC-1's role in enhancing mitochondrial calcium buffering capacity, which helps cancer cells withstand the oxidative stress and calcium overload conditions that would normally trigger cell death in normal cells.

When designing research to investigate SCaMC-1 expression patterns, it is important to include appropriate controls and use quantitative methods such as western blotting with mitochondrial loading controls (e.g., hsp60) to accurately assess relative expression levels across different cell types .

What are the standard methods for isolating and purifying recombinant SCaMC-1 protein?

The purification of recombinant SCaMC-1 requires careful attention to maintain protein functionality. A recommended approach involves:

  • Cloning the full-length SCaMC-1 cDNA into an appropriate expression vector with a purification tag (typically His-tag or FLAG-tag).

  • Expressing the protein in a eukaryotic expression system, such as COS-7 cells, which have been successfully used for SCaMC-1 expression studies . Optimizing transfection conditions is critical, as expression levels directly affect protein localization patterns.

  • Preparing mitochondrial-enriched extracts through differential centrifugation followed by affinity chromatography using the engineered tag.

  • Verifying protein identity and purity through western blotting with specific antibodies against SCaMC-1 .

Researchers should be aware that expression levels influence the subcellular localization of SCaMC-1. Studies have shown that at lower expression levels, SCaMC-1 predominantly shows mitochondrial localization, while higher expression levels can result in extra-mitochondrial aggregation . The table below summarizes the relationship between DNA concentration, expression level, and subcellular distribution:

DNA Quantity Used (μg)Mitochondrial Localization (%)Cytosolic Distribution (%)Extra-mitochondrial Aggregates (%)
0.5~70~20~10
1.0~50~30~20
2.0~30~35~35

Note: Values approximated from the described experimental results in the literature .

How can researchers design experiments to investigate SCaMC-1's role in mitochondrial calcium buffering?

Investigating SCaMC-1's role in mitochondrial calcium buffering requires sophisticated experimental approaches that can distinguish between direct effects on calcium transport and indirect effects through adenine nucleotide transport. A comprehensive experimental design should include:

  • Generation of SCaMC-1 knockdown and control cell lines using RNA interference technology. Stable SCaMC-1-knockdown (SCaMC-1-KD) cell lines can be created using appropriate parental lines such as COS-7 or 143B cells . The knockdown efficiency should be verified at both mRNA and protein levels, with typical experiments achieving 60-70% reduction in SCaMC-1 expression .

  • Measurement of mitochondrial calcium uptake kinetics using fluorescent calcium indicators or mitochondrially targeted calcium-sensitive proteins such as aequorin. Studies have shown that the same amount of extra-mitochondrial calcium (e.g., 10 μM) causes significantly greater elevation in mitochondrial calcium concentration in cells with reduced SCaMC-1 expression .

  • Determination of calcium retention capacity (CRC) by monitoring calcium-induced mitochondrial membrane potential changes using fluorescent indicators like rhodamine 123 or TMRM. This approach allows researchers to measure the amount of calcium required to trigger mitochondrial permeability transition .

  • Assessment of the impact of adenine nucleotides on mitochondrial calcium buffering through controlled addition of ATP-Mg or ADP in permeabilized cells with varying levels of SCaMC-1 expression .

  • Complementary rescue experiments involving re-expression of SCaMC-1 in knockdown cells using synonymous mutations to evade the RNAi mechanism, thus confirming specificity of observed effects .

These approaches collectively provide robust evidence for SCaMC-1's specific role in calcium buffering within mitochondria.

What evidence supports SCaMC-1 as a potential target for cancer therapy?

The potential of SCaMC-1 as a cancer therapy target is supported by several lines of evidence:

  • Differential expression: SCaMC-1 is consistently overexpressed in a wide range of tumors and cancer cell lines compared to normal tissues . This overexpression appears to be a general feature of transformed cells, suggesting a fundamental role in cancer cell biology.

  • Functional advantage: Knockdown experiments have demonstrated that SCaMC-1 reduction sensitizes cancer cells specifically to oxidative stress-induced cell death, while having no effect on apoptosis induced by other pathways . This specificity is valuable for potential therapeutic targeting.

  • Protective mechanism: SCaMC-1 exerts a negative feedback control between cellular Ca²⁺ overload and mPT-dependent cell death . By reducing SCaMC-1 activity, cancer cells would become more vulnerable to oxidative stress and calcium overload, which are common conditions in the tumor microenvironment.

  • Experimental validation: Re-expression of SCaMC-1 in knockdown cells, as well as overexpression in cells with low endogenous SCaMC-1 levels, renders cells more resistant to H₂O₂- or C₂-ceramide-induced cell death . This confirms the direct relationship between SCaMC-1 expression and cell survival under stress conditions.

Researchers exploring SCaMC-1 as a therapeutic target should design experiments that specifically address the following questions:

  • How does inhibition of SCaMC-1 affect tumor growth in vivo?

  • What are the potential off-target effects of SCaMC-1 inhibition in normal tissues?

  • Can SCaMC-1 inhibition enhance the efficacy of existing cancer treatments that induce oxidative stress?

What is the relationship between SCaMC-1 and its paralog SCaMC-1L in mammals?

SCaMC-1L (SCaMC-1Like) represents a fascinating example of evolutionary innovation through gene duplication. This paralog emerged by a tandem duplication specific to mammals, creating a head-to-tail array where both genes share similar intron-exon organization .

The key aspects of the SCaMC-1/SCaMC-1L relationship include:

  • Structural similarities: Both proteins contain EF-hand calcium-binding motifs in their N-terminal domains and share the characteristic six transmembrane helices of mitochondrial carriers in their C-terminal regions .

  • Differential expression patterns: While SCaMC-1 is widely expressed in various tissues and particularly abundant in cancer cells, SCaMC-1L shows a highly specific expression pattern primarily during spermatogenesis . This tissue-specific expression suggests functional specialization following gene duplication.

  • Developmental regulation: SCaMC-1L expression is developmentally regulated during spermatogenesis, with detection in late pachytene spermatocytes, round spermatids, and elongating/elongated spermatids .

  • Subcellular localization differences: Unlike SCaMC-1, which predominantly localizes to mitochondria, SCaMC-1L shows a more complex localization pattern in developing sperm cells, including association with the chromatoid body (identified by co-localization with eIF4E and MVH) .

These differences suggest that following duplication, SCaMC-1L has evolved specialized functions in germ cell development, while SCaMC-1 retained and perhaps enhanced its role in cellular metabolism and stress response.

What are the optimal protocols for measuring SCaMC-1-mediated adenine nucleotide transport?

Measuring SCaMC-1-mediated adenine nucleotide transport requires careful experimental design to distinguish it from other mitochondrial transporters. The recommended protocol involves:

  • Isolation of intact mitochondria from cells with varying levels of SCaMC-1 expression (control, knockdown, or overexpression) .

  • Permeabilization of the outer mitochondrial membrane using digitonin (typically 0.01%) while maintaining inner membrane integrity.

  • Use of carboxyatractyloside (CAT) to inhibit the adenine nucleotide translocase (ANT), thereby isolating SCaMC-1-specific transport activity. The typical CAT concentration used is 5-10 μM .

  • Measurement of ATP-Mg or ADP uptake in the presence of varying calcium concentrations (0-5 μM) to demonstrate calcium-dependence of transport .

  • Inclusion of phosphate (Pi) to assess reversibility of the transport process, as Pi addition reverses the activity of the transporter with similar calcium dependence .

  • Quantification of transport using either radiolabeled nucleotides or luciferase-based ATP detection methods.

The data should be presented as transport rates (nmol/min/mg protein) plotted against calcium concentration, with sigmoid curves typically observed with half-maximal activation at approximately 3.4 μM Ca²⁺ . In SCaMC-1 knockdown cells, the CAT-insensitive/Ca²⁺-dependent ATP-Mg/ADP transport is typically reduced to approximately 55-56% of the control rate .

How can researchers evaluate the impact of SCaMC-1 on mitochondrial permeability transition?

Evaluation of SCaMC-1's impact on mitochondrial permeability transition (mPT) requires multiple complementary approaches:

  • Cell death assays: Compare the susceptibility of control and SCaMC-1-manipulated cells to oxidative stress-induced cell death using agents such as H₂O₂ or menadione. Cell viability can be assessed using standard methods such as MTT assay, propidium iodide staining, or annexin V/PI double staining to distinguish between necrotic and apoptotic death .

  • Mitochondrial membrane potential measurements: Use potentiometric fluorescent dyes such as tetramethylrhodamine methyl ester (TMRM) or JC-1 to monitor mitochondrial membrane potential in intact cells following calcium mobilization or oxidative stress. In SCaMC-1-KD cells, mitochondrial depolarization occurs more rapidly and at lower calcium concentrations (typically 0.5-1 μM) compared to control cells .

  • Calcium retention capacity (CRC) measurements: Assess the amount of calcium required to trigger mPT by sequentially adding calcium to permeabilized cells or isolated mitochondria while monitoring calcium uptake and membrane potential. CRC is reduced in mitochondria with decreased SCaMC-1 levels .

  • Confirmation of mPT involvement: Use specific inhibitors of mPT such as cyclosporin-A (CsA) and bongkrekic acid (BKA) to verify that the observed effects are indeed due to mPT. These inhibitors should prevent mitochondrial depolarization in SCaMC-1-KD cells, confirming the role of mPT in the observed phenotype .

  • Rescue experiments: Re-express SCaMC-1 in knockdown cells using synonymous mutations to evade RNAi targeting, or overexpress SCaMC-1 in cells with low endogenous levels. These manipulations should restore resistance to oxidative stress and calcium overload if the effects are specifically mediated by SCaMC-1 .

This multi-faceted approach provides comprehensive evidence for SCaMC-1's role in regulating mPT sensitivity.

What techniques are available for visualizing SCaMC-1 localization in different cell types?

Visualizing SCaMC-1 localization requires techniques that can distinguish between mitochondrial and non-mitochondrial pools of the protein. Recommended approaches include:

  • Immunofluorescence microscopy: Use specific antibodies against SCaMC-1 along with established mitochondrial markers such as COX-I (cytochrome c oxidase subunit I) . This approach allows for co-localization analysis to confirm mitochondrial targeting.

  • Expression of tagged proteins: Transfect cells with vectors expressing SCaMC-1 fused to fluorescent proteins or epitope tags (e.g., FLAG) . Titrate expression levels carefully, as high expression can lead to protein aggregation and altered subcellular distribution.

  • Specialized preparation techniques for specific cell types: For sperm cells and spermatids, techniques such as squash preparations of seminiferous tubules or drying-down preparations offer superior preservation of cellular architecture .

  • Sub-cellular fractionation: Isolate mitochondrial, cytosolic, and nuclear fractions through differential centrifugation followed by western blotting to quantitatively assess SCaMC-1 distribution .

  • Super-resolution microscopy techniques: For detailed analysis of SCaMC-1 distribution within mitochondria, techniques such as STED (Stimulated Emission Depletion) or PALM (Photoactivated Localization Microscopy) can provide nanometer-scale resolution.

Researchers should be aware that SCaMC-1 localization patterns can change depending on expression levels and cellular conditions. When expressed at high levels in COS-7 cells, SCaMC-1 can form extra-mitochondrial aggregates with aggresomal features, including co-localization with γ-Tubulin at the microtubule-organizing center (MTOC) . These aggregates are dependent on the integrity of the microtubule network, as treatment with nocodazole causes their dispersion .

How should researchers interpret contradictory findings regarding SCaMC-1's function in different experimental systems?

When facing contradictory findings regarding SCaMC-1 function, researchers should consider several factors that might influence results:

  • Cell type-specific effects: SCaMC-1 function may vary between different cell types due to differential expression of interacting proteins or signaling pathways. Compare expression levels of other mitochondrial carriers and calcium handling proteins between experimental systems.

  • Expression level artifacts: Overexpression studies can lead to mislocalization and aggregation of SCaMC-1, as demonstrated by the formation of extra-mitochondrial aggregates when SCaMC-1 is expressed at high levels . Validate findings with endogenous protein whenever possible.

  • Methodological differences: Variations in experimental conditions such as calcium concentration, pH, or adenine nucleotide levels can significantly impact SCaMC-1 activity. Standardize these parameters across experiments to ensure comparability.

  • Temporal considerations: SCaMC-1's role may differ depending on the duration of stress exposure. Short-term versus long-term responses to calcium or oxidative stress might involve different regulatory mechanisms.

  • Compensatory mechanisms: In knockdown or knockout studies, compensatory upregulation of related transporters might mask SCaMC-1's function. Consider examining the expression of other SCaMC family members.

When analyzing contradictory data, researchers should:

  • Directly compare the methodologies used in different studies

  • Test multiple cell types under identical conditions

  • Use both gain-of-function and loss-of-function approaches

  • Validate findings with complementary techniques

This systematic approach can help resolve contradictions and establish a more comprehensive understanding of SCaMC-1 function.

What are the best practices for analyzing SCaMC-1 expression data in cancer versus normal tissues?

When analyzing SCaMC-1 expression data in cancer versus normal tissues, researchers should follow these best practices:

By following these practices, researchers can generate more reliable and interpretable data on SCaMC-1 expression differences between cancer and normal tissues, which is essential for evaluating its potential as a biomarker or therapeutic target.

What are the most promising research areas for advancing understanding of SCaMC-1 function?

Several promising research areas could significantly advance our understanding of SCaMC-1 function:

  • Structure-function studies: Determining the high-resolution structure of SCaMC-1, particularly in different conformational states (calcium-bound vs. calcium-free), would provide crucial insights into its transport mechanism and enable rational design of specific inhibitors.

  • In vivo models: Developing tissue-specific conditional knockout mouse models of SCaMC-1 would allow assessment of its physiological roles in different contexts, particularly in cancer development and progression.

  • Regulatory mechanisms: Investigating transcriptional, post-transcriptional, and post-translational regulation of SCaMC-1 would enhance our understanding of how its expression and activity are controlled in normal and pathological conditions.

  • Interaction partners: Comprehensive identification of SCaMC-1-interacting proteins through approaches such as proximity labeling or co-immunoprecipitation coupled with mass spectrometry could reveal new functional connections.

  • Mitochondrial calcium dynamics: Exploring the relationship between SCaMC-1 activity and other mitochondrial calcium transport systems (MCU complex, NCLX) would provide a more integrated view of mitochondrial calcium homeostasis.

  • Cancer metabolism: Investigating how SCaMC-1 contributes to metabolic reprogramming in cancer cells could reveal new therapeutic strategies targeting cancer-specific vulnerabilities in energy metabolism.

  • Evolutionary significance: Comparative studies of SCaMC-1 and its paralog SCaMC-1L could provide insights into the process of functional specialization following gene duplication .

These research directions collectively address fundamental questions about SCaMC-1 biology while also exploring its potential clinical relevance.

How can researchers develop specific inhibitors or modulators of SCaMC-1 activity for potential therapeutic applications?

Development of specific SCaMC-1 inhibitors or modulators requires a systematic approach:

  • Target validation: Confirm SCaMC-1 as a viable therapeutic target by demonstrating that its inhibition selectively affects cancer cells while sparing normal tissues. This involves comprehensive analysis of SCaMC-1 dependency across diverse cancer types and normal cell populations.

  • Assay development: Establish robust high-throughput screening assays for SCaMC-1 activity. This could involve reconstitution of purified SCaMC-1 in liposomes to measure calcium-dependent adenine nucleotide transport, or cellular assays measuring mitochondrial calcium retention capacity in SCaMC-1-expressing cells .

  • Structure-based drug design: Utilize structural information about SCaMC-1, particularly focusing on regions that distinguish it from other mitochondrial carriers. The substrate-binding residues in transmembrane helices H2, H4, and H6 represent potential targets for small molecule inhibitors .

  • Screening strategies: Employ both virtual screening approaches based on structural models and experimental screening of chemical libraries. Candidates should be evaluated for:

    • Specificity for SCaMC-1 over other mitochondrial carriers

    • Ability to modulate calcium-dependent transport activity

    • Cell permeability and mitochondrial targeting

  • Validation studies: Assess promising compounds for their ability to:

    • Reduce mitochondrial calcium buffering capacity

    • Sensitize cancer cells to oxidative stress and calcium overload

    • Show selective toxicity toward cancer cells versus normal cells

    • Demonstrate efficacy in preclinical cancer models

  • Optimization: Refine lead compounds through medicinal chemistry approaches to improve potency, specificity, pharmacokinetics, and safety profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.