Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-2 (Slc25a25)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Physiology

SCaMC-2 operates as a calcium-sensitive ATP-Mg/P<sub>i</sub> exchanger with the following activities:

  • Transports Mg-ATP into mitochondria in exchange for phosphate (P<sub>i</sub>)

  • Regulates adenine nucleotide pools under Ca<sup>2+</sup>-elevated conditions

  • Maintains mitochondrial ATP levels during energy-demanding processes

Calcium dependency:

  • Ca<sup>2+</sup> binding induces conformational changes in EF-hand domains, activating transport

  • Half-maximal activation occurs at ~300 nM Ca<sup>2+</sup>

Experimental Applications

Recombinant SCaMC-2 is widely used in:

ApplicationProtocol Details
Western Blot (WB)Detected using anti-SLC25A25 antibodies (IgG2a, clone 4D8)
ELISAQuantified via FLISA with 85% linear detection range
ImmunohistochemistryLocalized to mitochondrial inner membrane in murine tissues

Key validation studies:

  • Demonstrated functional rescue in Drosophila melanogaster models lacking endogenous SCaMC

  • Confirmed ATP-Mg/P<sub>i</sub> exchange activity in proteoliposome reconstitution assays

Table 1: Key Studies Involving Recombinant SCaMC-2

Study FocusModel SystemMajor FindingSource
Calcium signalingZebrafish embryosSlc25a25b knockdown disrupts left-right patterning via Nodal cascade inhibition
Metabolic regulationHEK293 cellsLinks TRPP2-mediated Ca<sup>2+</sup> signals to mitochondrial ATP dynamics
Structural analysisNMR spectroscopyGDP-bound UCP2 structure reveals pore-like transport mechanism

Disease associations:

  • Mutations in human SLC25A25 correlate with cerebral hypomyelination and motor deficits

  • Overexpression exacerbates nucleoside-induced mitochondrial DNA depletion in cardiomyocytes

Comparative Analysis Across Species

Zebrafish homologs:

  • SCaMC-2-A (slc25a25a) and SCaMC-2-B (slc25a25b) show 78% sequence identity with murine SCaMC-2

  • Functional redundancy observed in ATP transport but differential tissue expression

Evolutionary conservation:

  • EF-hand motifs and MCF domains conserved from Drosophila to mammals

  • Human SLC25A25 fully rescues fertility defects in SCaMC-null flies

Technical Limitations and Future Directions

  • Current challenges:

    • Low thermostability without Ca<sup>2+</sup> (T<sub>m</sub> = 49.5°C vs. 43.2°C in Ca<sup>2+</sup>-free state)

    • Limited structural data for Ca<sup>2+</sup>-bound conformations

  • Emerging applications:

    • High-throughput screening for mitochondrial toxicity in drug development

    • Gene therapy vectors for SCaMC-2 deficiency disorders

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a25; Kiaa1896; Scamc2; Calcium-binding mitochondrial carrier protein SCaMC-2; Small calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-469
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a25
Target Protein Sequence
MLCLCLYVPIAGAAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGD KDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAE KILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEE RQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIVGGFTQMIREGGAK SLWRGNGINVLKIAPESAIKFMAYEQMKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYP MEVLKTRMALRKTGQYSGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYAGIDLAVYETL KNTWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASIEGAPEVTMS SLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. This protein may function as an ATP-Mg/Pi exchanger, mediating the movement of Mg-ATP in exchange for phosphate. This process catalyzes the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Gene References Into Functions
  1. These findings suggest that KD feeding induces expression of the muscle circadian gene Slc25a25 via neural pathways, and that SLC25A25 might be involved in muscle thermogenesis under KD-induced hypothermia in mammals. PMID: 28588221
  2. Induction of Slc25a25 in mice with an intact gene may contribute to an alternative thermogenic pathway for the maintenance of body temperature during cold stress. PMID: 21296886
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SCaMC-2/SLC25A25 and what are its primary functions in cellular metabolism?

SCaMC-2, encoded by the SLC25A25 gene, functions as a calcium-activated mitochondrial ATP transporter that plays a crucial role in linking cellular calcium signaling to mitochondrial metabolism . The protein belongs to the solute carrier family 25 and is also known as Mitochondrial ATP-Mg/Pi Carrier Protein 3, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 3, and Small Calcium-binding Mitochondrial Carrier Protein 2 . Functionally, SLC25A25 cooperates with TRPP2, a calcium-permeable cation channel in cilia, within an evolutionarily conserved metabolic signaling pathway . This pathway is essential for multiple physiological processes, as evidenced by the fact that loss of SLC25A25-mediated signaling impairs cellular metabolism and causes severe developmental defects, including abnormal left-right patterning and male fertility problems in animal models .

Methodologically, researchers investigating SCaMC-2 function should consider both metabolic flux analysis and calcium signaling assays to comprehensively characterize its role in coordinating mitochondrial ATP transport with cellular calcium dynamics.

How is SCaMC-2/SLC25A25 protein structure organized to facilitate its calcium-dependent transport activity?

The SCaMC-2/SLC25A25 protein possesses distinct functional domains dedicated to transport activity and calcium binding . Similar to other members of the mitochondrial carrier family, it contains transmembrane domains that form the translocation pathway for adenine nucleotides. The calcium-binding capability resides in specific EF-hand motifs located at the N-terminal domain, which undergo conformational changes upon calcium binding . This structural organization enables the protein to function as a calcium sensor that can modulate mitochondrial ATP transport in response to changes in cytosolic calcium levels.

In experimental approaches, researchers should consider both the calcium-free and calcium-bound states when analyzing protein stability and function. Thermal stability assays have shown that SLC25A25 exhibits a biphasic unfolding profile with different apparent melting temperatures depending on calcium binding status (calcium-bound state: Tm = 49.5°C) . This information is critical for designing purification protocols and functional assays.

What are the most effective methods for detecting and quantifying SCaMC-2/SLC25A25 expression in experimental systems?

For detection and quantification of SCaMC-2/SLC25A25, Western blot and ELISA represent the most validated technical approaches . When performing Western blot analysis, researchers should use appropriately validated antibodies specific to SCaMC-2/SLC25A25. Commercial antibodies, such as mouse monoclonal IgG2a,k (Clone 4D8) that has been purified by Protein A Affinity Chromatography, have demonstrated specificity for human SLC25A25 .

For most experimental purposes, a methodological approach combining both protein and mRNA quantification is recommended. While Western blot provides information about protein abundance, RT-qPCR allows researchers to monitor transcript levels, which can be particularly valuable when investigating transcriptional regulation or when protein detection proves challenging due to low expression levels or technical limitations.

What experimental systems are available for studying SCaMC-2/SLC25A25 function, and what are their respective advantages?

Multiple experimental systems have been established for investigating SCaMC-2/SLC25A25 function:

Each system offers distinct advantages: purified protein systems provide direct mechanistic insights, cellular models allow investigation of metabolic integration, and animal models enable understanding of physiological relevance in complex developmental processes.

How does SCaMC-2/SLC25A25 integrate with TRPP2-mediated calcium signaling to regulate developmental processes?

SCaMC-2/SLC25A25 functions downstream of TRPP2 (a calcium-permeable cation channel located in cilia) within a conserved signaling pathway that links ciliary calcium signaling to mitochondrial metabolism . This integration is particularly evident in left-right patterning during embryonic development. Mechanistically, TRPP2 mediates calcium influx, which activates SLC25A25 to modulate mitochondrial ATP transport. This signaling axis ultimately regulates the Nodal signaling cascade, which is essential for establishing left-right asymmetry .

Experimental evidence supporting this pathway includes:

  • Knockdown of slc25a25b in zebrafish randomizes the expression of southpaw (Nodal) in the lateral plate mesoderm .

  • Additional Nodal signaling cascade members, including dand5 (Cerl2) and lefty2, are also affected by slc25a25b knockdown .

  • These observations place SLC25A25 upstream of the Nodal cascade, providing a molecular link between TRPP2-mediated calcium signals and asymmetric gene expression .

For researchers investigating this pathway, combined approaches monitoring calcium dynamics, mitochondrial function, and developmental gene expression are recommended to fully characterize the signaling relationships.

What is the role of SCaMC-2/SLC25A25 in regulating mitochondrial metabolism, and how can researchers quantify these effects?

To quantify these metabolic effects, researchers should employ a multi-faceted methodological approach:

  • Respiration analysis: Measure oxygen consumption rates in intact cells and isolated mitochondria using high-resolution respirometry or plate-based extracellular flux analyzers to quantify changes in oxidative phosphorylation.

  • Metabolomics profiling: Conduct broad-coverage discovery metabolomics to identify specific metabolic pathways affected by SLC25A25 activity or deficiency .

  • ATP transport assays: Directly measure calcium-dependent ATP transport using reconstituted SLC25A25 in liposomes or isolated mitochondria to assess transporter kinetics and regulation.

  • Calcium imaging: Monitor mitochondrial and cytosolic calcium dynamics to correlate calcium signaling with metabolic alterations mediated by SLC25A25.

What are the common challenges in working with recombinant SCaMC-2/SLC25A25 protein, and how can these be addressed?

Researchers working with recombinant SCaMC-2/SLC25A25 often encounter several technical challenges:

  • Protein stability issues: The biphasic unfolding profile of SLC25A25 reflecting calcium-bound (Tm = 49.5°C) and calcium-free states complicates protein handling . To address this, maintain appropriate calcium concentrations during purification and storage, and consider performing functional assays at physiologically relevant calcium concentrations.

  • Expression system selection: Different expression systems yield varying protein quality and quantity. For research applications requiring high purity, cell-free expression systems have been successfully used for recombinant zebrafish SCaMC-2 variants, yielding protein with ≥85% purity as determined by SDS-PAGE .

  • Antibody specificity: When detecting SLC25A25 by immunological methods, antibody cross-reactivity with related mitochondrial carriers can occur. Validated antibodies, such as mouse monoclonal IgG2a,k (Clone 4D8), have demonstrated specificity for human SLC25A25 in applications including ELISA and Western blot .

  • Activity preservation: Transport activity can be lost during purification and reconstitution. To preserve activity, optimize detergent selection during solubilization and consider reconstitution into liposomes with lipid compositions that mimic the mitochondrial inner membrane.

How can researchers effectively distinguish between the functions of different SCaMC/SLC25A25 isoforms in their experimental systems?

Multiple SCaMC/SLC25A25 isoforms exist across species, including paralogues within the same organism (e.g., zebrafish slc25a25a and slc25a25b) . Additionally, alternative splicing can generate multiple isoforms from a single gene. Researchers must employ specific strategies to distinguish between these variants:

  • Isoform-specific antibodies: Use antibodies that specifically recognize epitopes unique to each isoform. Validate antibody specificity using recombinant proteins or knockout/knockdown controls.

  • Targeted genetic approaches: Employ CRISPR-Cas9 or RNAi approaches targeted to isoform-specific sequences to selectively modulate expression of individual isoforms.

  • Rescue experiments: As demonstrated with human SLC25A25 rescuing Drosophila SCaMC function in male fertility , complementation assays can determine functional conservation and specificity of different isoforms.

  • Isoform-specific expression analysis: Utilize RT-qPCR with primers designed against unique regions of each isoform to quantify their relative expression across tissues or experimental conditions.

  • Recombinant protein characterization: Compare biochemical properties of purified isoforms, particularly regarding calcium sensitivity, substrate specificity, and transport kinetics.

What are emerging areas of research regarding SCaMC-2/SLC25A25 in disease contexts?

While the physiological functions of SCaMC-2/SLC25A25 in development and metabolism are being elucidated, its potential roles in disease contexts represent important emerging research areas. Based on its fundamental functions, several disease-relevant research directions warrant investigation:

  • Metabolic disorders: Given that SLC25A25 deficiency alters 42 metabolites and reduces cellular respiration , its role in metabolic diseases, particularly those involving mitochondrial dysfunction, merits exploration.

  • Fertility disorders: The requirement of SCaMC/SLC25A25 for male fertility in Drosophila suggests potential relevance to mammalian fertility disorders, which could be investigated using targeted knockout approaches in mammalian models.

  • Developmental disorders: SLC25A25's role in left-right patterning through regulation of the Nodal cascade suggests it may contribute to congenital disorders involving organ situs or asymmetry defects.

  • Ciliopathies: The functional interaction between SLC25A25 and the ciliary calcium channel TRPP2 indicates potential involvement in ciliopathies, a diverse group of disorders caused by ciliary dysfunction.

Methodologically, researchers should combine genetic association studies with functional characterization in relevant disease models to establish causal relationships between SLC25A25 dysfunction and pathological states.

How might advances in calcium imaging and metabolomics technologies enhance our understanding of SCaMC-2/SLC25A25 function?

Emerging technologies in calcium imaging and metabolomics present opportunities to gain deeper insights into SCaMC-2/SLC25A25 function:

  • Spatiotemporally resolved calcium imaging: Genetically encoded calcium indicators targeted to specific subcellular compartments can enable real-time monitoring of calcium dynamics at mitochondria-ER contact sites or near ciliary bases where SLC25A25 may be functionally important. This approach can reveal how local calcium microdomains regulate SLC25A25 activity in situ.

  • Single-cell metabolomics: Advances in mass spectrometry now enable metabolic profiling at the single-cell level, which could reveal cell-type specific metabolic consequences of SLC25A25 function or deficiency that might be masked in bulk tissue analyses.

  • In situ transport assays: Development of fluorescent reporters for ATP transport across the mitochondrial membrane could enable direct visualization of SLC25A25 activity in living cells, correlated with calcium signals and metabolic states.

  • Multi-omics integration: Combined analysis of metabolomics, proteomics, and transcriptomics data from SLC25A25-deficient models can provide a systems-level understanding of how this transporter influences cellular metabolism and signaling networks.

  • Structural biology approaches: Cryo-EM or X-ray crystallography of SLC25A25 in different conformational states (calcium-bound vs. calcium-free) would provide crucial insights into the molecular mechanisms of calcium-dependent transport regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.