Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23)

Shipped with Ice Packs
In Stock

Description

Calcium-Dependent ATP-Mg/P<sub>i</sub> Transport

SCaMC-3 mediates electroneutral exchange of Mg-ATP with inorganic phosphate (P<sub>i</sub>), critical for maintaining mitochondrial adenine nucleotide pools. This activity is activated by cytosolic calcium signals (~3.3 μM Ca<sup>2+</sup>) .

Regulation of Mitochondrial Calcium Uptake

SCaMC-3 interacts with the mitochondrial calcium uniporter (MCU) and its regulator MICU1, enhancing mitochondrial Ca<sup>2+</sup> uptake capacity . Knockdown studies show reduced Ca<sup>2+</sup> influx and altered reactive oxygen species (ROS) dynamics .

Neuroprotection Against Excitotoxicity

In neurons, SCaMC-3 preserves mitochondrial ATP levels during NMDA receptor overactivation, delaying calcium deregulation and cell death. Slc25a23<sup>-/-</sup> neurons exhibit accelerated ATP depletion and increased vulnerability to excitotoxic insults .

Research Applications

Recombinant SCaMC-3 is utilized in:

  • Mechanistic Studies: Reconstitution in liposomes to analyze transport kinetics .

  • Protein-Protein Interaction Assays: Co-immunoprecipitation with MCU/MICU1 .

  • Structural Analysis: NMR and crystallography to resolve calcium-induced conformational changes .

Experimental Findings

Model SystemKey ResultCitation
HeLa CellsSLC25A23 knockdown reduces mitochondrial Ca<sup>2+</sup> uptake by 40%
Mouse Cortical NeuronsSlc25a23<sup>-/-</sup> neurons show 2x faster ATP depletion under glutamate stress
Yeast ComplementationSCaMC-3L (short isoform) restores ATP-Mg/P<sub>i</sub> exchange in SAL1 mutants

Pathophysiological Implications

  • Neurodegeneration: SCaMC-3 deficiency exacerbates mitochondrial dysfunction in excitotoxicity, a hallmark of stroke and epilepsy .

  • Cancer: Overexpression of human SCaMC-3 homologs (e.g., SLC25A24) correlates with chemoresistance by buffering mitochondrial calcium .

  • Innate Immunity: SLC25A23 attenuates antiviral responses by suppressing MAVS ubiquitination, suggesting therapeutic targeting potential .

Comparative Analysis of SCaMC Paralogs

FeatureSCaMC-3 (Slc25a23)SCaMC-1 (Slc25a24)SCaMC-3L (Slc25a41)
Calcium RegulationYes (EF-hand dependent)YesNo
Tissue ExpressionBroad (brain, liver, heart)Testis, brainTestis-predominant
Transport ActivityATP-Mg/P<sub>i</sub>ATP-Mg/P<sub>i</sub>ATP-Mg/P<sub>i</sub>
Knockout PhenotypeReduced Ca<sup>2+</sup> uptakeEmbryonic lethalViable, no overt phenotype
Data compiled from

Technical Considerations for Recombinant Protein Use

  • Storage: Tris-based buffer with 50% glycerol; stable at -80°C .

  • Purity: >90% via SDS-PAGE .

  • Activity Assays: Requires reconstitution in lipid bilayers with calcium for functional studies .

Unresolved Questions

  • How do SCaMC-3 splice variants (e.g., lacking exon 10) alter substrate specificity ?

  • What structural mechanisms underlie calcium-induced conformational changes ?

  • Can SCaMC-3 modulation mitigate diseases like epilepsy or neurodegeneration ?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a23; Scamc3; Calcium-binding mitochondrial carrier protein SCaMC-3; Small calcium-binding mitochondrial carrier protein 3; Solute carrier family 25 member 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-467
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a23
Target Protein Sequence
MRGGSSDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGRGDPDRAQQGVSSDWDAD PDGGLSLEEFTRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKI LHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSQEEKL TGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKSNRLNILGGLRNMIQEGGVLSL WRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETLHVQERFVAGSLAGATAQTIIYPME VLKTRLTLRRTGQYKGLLDCAKRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKN RWLQQYSHESANPGILVLLGCGTISSTCGQIASYPLALVRTRMQAQASIEGGPQVSMVGL LRHILSQEGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR
Uniprot No.

Target Background

Function
Recombinant Mouse Calcium-binding mitochondrial carrier protein SCaMC-3 (Slc25a23) is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. SCaMC-3 may function as an ATP-Mg/Pi exchanger, mediating the transport of Mg-ATP in exchange for phosphate, thereby catalyzing the net uptake or efflux of adenine nucleotides. It also acts as a regulator of mitochondrial calcium uptake through interaction with MCU and MICU1.
Gene References Into Functions
  1. SCaMC-3 knockout neurons exhibit increased vulnerability to in vitro excitotoxicity, and SCaMC-3 knockout mice show heightened susceptibility to kainate-induced seizures. PMID: 25716855
  2. Glucagon's regulation of oxidative phosphorylation necessitates an increase in matrix adenine nucleotide content via Ca2+ activation of the mitochondrial ATP-Mg/Pi carrier SCaMC-3. PMID: 23344948
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Slc25a23 in mitochondrial calcium regulation?

Slc25a23 functions as a calcium-activated ATP-Mg/Pi carrier that augments mitochondrial Ca²⁺ uptake. It interacts with the mitochondrial calcium uniporter (MCU) and its regulatory protein MICU1, forming part of the mitochondrial Ca²⁺ uptake machinery. Knockdown studies have demonstrated that Slc25a23 specifically decreases mitochondrial Ca²⁺ uptake without altering the efflux rate, confirming its role in calcium influx rather than efflux processes .

Research has shown that Slc25a23 is highly expressed in metabolically active tissues including brain, heart, skeletal muscle, liver, and small intestine, suggesting tissue-specific importance in regulating mitochondrial calcium dynamics . The protein's EF-hand domains are crucial for its function, as these calcium-sensing motifs enable Slc25a23 to respond to changes in calcium concentration and modulate mitochondrial calcium uptake accordingly.

How does Slc25a23 differ from other members of the SLC25 carrier family?

While Slc25a23 belongs to a subfamily of carriers that includes Slc25a24 and Slc25a25, functional studies reveal distinct roles. Unlike its family members, knockdown of specifically Slc25a23 reduces mitochondrial Ca²⁺ uptake, while knockdown of Slc25a24 and Slc25a25 does not significantly alter calcium influx rate, efflux rate, or total mitochondrial calcium concentration .

All three carriers contain calcium-binding EF-hand motifs and localize to the mitochondrial inner membrane, but their functional impacts differ. The unique role of Slc25a23 in calcium regulation appears linked to its specific interaction with MCU and MICU1 components of the mitochondrial calcium uptake complex, an interaction not observed with the other family members in the studies reviewed .

What experimental models are typically used to study Slc25a23 function?

Research on Slc25a23 typically employs several experimental models:

Model SystemApplicationKey Measurements
HeLa cell linesKnockdown studiesMitochondrial Ca²⁺ uptake, ROS production
COS7 cellsProtein interaction studiesCo-immunoprecipitation with MCU/MICU1
Permeabilized cellsDirect measurement of mitochondrial Ca²⁺ dynamicsCa²⁺ uptake rate, efflux rate
Isolated mitoplastsElectrophysiological studiesCa²⁺ current measurements

Researchers typically create stable knockdown cell lines using specific shRNA sequences targeting Slc25a23. The effectiveness of knockdown is confirmed through Western blot analysis, and rescue experiments involving reexpression of Slc25a23 help validate observed phenotypes .

What techniques are used to measure Slc25a23-mediated calcium uptake in mitochondria?

Advanced calcium imaging and electrophysiological techniques are essential for characterizing Slc25a23's role in mitochondrial calcium dynamics:

  • Permeabilized Cell Calcium Uptake Assays: This methodology involves suspending permeabilized cells in intracellular matrix (ICM) buffer containing succinate to energize mitochondria and thapsigargin to inhibit ER Ca²⁺ uptake via SERCA. Fura-2FF is added as a calcium indicator to monitor extramitochondrial calcium changes. Cells are then pulsed with defined Ca²⁺ concentrations (typically 10 μM) to measure mitochondrial uptake rate .

  • Mitoplast Patch Clamping: This direct electrophysiological approach measures mitochondrial calcium currents (I<sub>MCU</sub>). In whole-mitoplast configuration, adding 5 mM Ca²⁺ to the bath triggers an inwardly rectifying calcium current that can be quantified. Studies show this current is reduced in Slc25a23 knockdown mitoplasts in nominal phosphate buffer conditions, providing direct evidence of Slc25a23's influence on MCU activity .

  • Phosphate Supplementation Studies: Because Slc25a23 functions as an Mg-ATP/Pi carrier, researchers measure I<sub>MCU</sub> in control and Slc25a23 knockdown mitoplasts with and without phosphate supplementation (typically 300 μM). This approach reveals that phosphate increases I<sub>MCU</sub> in control but not in Slc25a23 knockdown mitoplasts, suggesting that the Mg-ATP/Pi carrier function of Slc25a23 enhances MCU activity .

How can researchers effectively analyze Slc25a23 protein interactions with the MCU complex?

Analyzing protein interactions between Slc25a23 and the MCU complex requires several complementary approaches:

  • Co-immunoprecipitation (Co-IP): This technique involves transfecting cells with tagged versions of the proteins of interest. For example, Flag-tagged Slc25a23 can be transfected into cells stably expressing GFP-tagged MCU or HA-tagged MICU1. Cell lysates are then subjected to immunoprecipitation followed by Western blot analysis. This approach has successfully demonstrated that immunoprecipitation of GFP-tagged MCU pulls down Slc25a23, and correspondingly, HA-tagged MICU1 pulls down Slc25a23 .

  • Functional Correlation Studies: After establishing physical interactions, researchers should conduct functional studies to determine whether these interactions affect calcium uptake. For instance, mitoplast patch clamping can measure calcium currents in various conditions, such as Slc25a23 knockdown or overexpression, to establish functional consequences of the interaction .

  • Domain Mapping: To identify which domains of Slc25a23 are critical for interaction with MCU or MICU1, researchers can generate truncated or mutated versions of Slc25a23 (particularly focusing on the EF-hand domains) and assess their ability to interact with MCU complex components and influence calcium uptake .

What are the recommended protocols for generating stable Slc25a23 knockdown cell lines?

Generating reliable Slc25a23 knockdown models requires careful attention to methodology:

  • shRNA Selection: Based on published research, the following shRNA sequences have proven effective for Slc25a23 knockdown:

    • #863: CCTGAATCTTAGACTCTTATA

    • #864: CGAGTCAGCTATCAAGTTCAT

    • #865: CGGCTGAACAGAATCGTTCAA

    • #866: CGTCTA (partial sequence)

  • Validation Strategy: Multiple knockdown clones should be generated and characterized to control for off-target effects. Researchers should select at least two independent shRNA constructs targeting different regions of Slc25a23 mRNA.

  • Knockdown Confirmation: Western blot analysis should be performed to quantify protein reduction. Both complete knockdown (#864) and partial knockdown (#863) clones have shown differential effects in previous studies, providing valuable comparison points .

  • Rescue Experiments: To confirm phenotype specificity, researchers should perform rescue experiments by reintroducing Slc25a23 into knockdown cells. This step is critical for establishing that observed phenotypes are directly attributable to Slc25a23 reduction rather than off-target effects .

How does Slc25a23 influence reactive oxygen species production and oxidative stress response?

Slc25a23 plays a significant role in regulating mitochondrial reactive oxygen species (mROS) and cellular responses to oxidative stress:

  • Basal ROS Regulation: Knockdown of Slc25a23 leads to lower basal mitochondrial superoxide levels compared to control cells, as measured using the mitochondrial-targeting superoxide indicator MitoSOX Red. Rescue experiments partially restore mROS levels, confirming the specificity of this effect. In contrast, knockdown of related carriers Slc25a24 and Slc25a25 does not affect basal mROS levels .

  • Antioxidant System Impact: Slc25a23 knockdown results in higher levels of reduced glutathione, a major cellular antioxidant. This increase in antioxidant capacity likely contributes to the reduced ROS observed in knockdown cells .

  • Cell Survival During Oxidative Challenge: Cells with reduced Slc25a23 expression exhibit strong global preservation of ATP when exposed to ROS stressors compared to control cells. This ATP preservation indicates maintained mitochondrial membrane potential and intact proton pumping during oxidative stress .

  • Protection Against Oxidant-Induced Cell Death: In cell death assays using t-butyl hydroperoxide (t-BH) challenge, Slc25a23 knockdown provides significant protection against oxidative stress-induced death. This protection is reversed in rescue experiments, confirming the specific role of Slc25a23 in mediating oxidant-induced cell death .

The table below summarizes the differences in oxidative stress parameters between control and Slc25a23 knockdown cells:

ParameterControl CellsSlc25a23 Knockdown CellsFunctional Impact
Basal mitochondrial ROSHigherLowerReduced oxidative damage
Reduced glutathione levelsLowerHigherEnhanced antioxidant capacity
ATP preservation during oxidative stressPoorStrongImproved bioenergetic maintenance
Cell death after t-BH challengeHighLowEnhanced cell survival

What experimental considerations are important when studying Slc25a23's role in calcium-mediated cell death?

When investigating Slc25a23's involvement in calcium-mediated cell death, researchers should consider these critical experimental factors:

  • Stimulus Selection: t-Butyl hydroperoxide (t-BH) is particularly useful for studying Slc25a23's role in cell death because t-BH-induced cell death specifically requires calcium and can be rescued by calcium chelation with EGTA. This establishes a direct link between Slc25a23, calcium handling, and t-BH-induced cell death .

  • Cell Death Assays: Researchers should employ multiple complementary approaches to assess cell death:

    • Annexin V and propidium iodide staining with confocal microscopy provides visual confirmation of cell death

    • ATP preservation assays offer a functional readout of mitochondrial integrity

    • Mitochondrial membrane potential measurements track bioenergetic status

  • Genetic Controls: Experiments should include:

    • Complete knockdown (#864)

    • Partial knockdown (#863) to assess dose-dependent effects

    • Rescue conditions where Slc25a23 is reintroduced into knockdown cells

    • Related family member controls (Slc25a24, Slc25a25) to establish specificity

  • Mechanistic Pathway Analysis: Researchers should consider blocking specific steps in the calcium-mediated cell death pathway to determine where Slc25a23 exerts its effects. For example, using Ru360 to block MCU or CGP37157 to inhibit the mitochondrial Na⁺/Ca²⁺ exchanger can help dissect which aspects of calcium signaling are modulated by Slc25a23 .

How should researchers interpret contradictory findings about Slc25a23's impact on mitochondrial bioenergetics?

When faced with seemingly contradictory findings regarding Slc25a23's effects on mitochondrial bioenergetics, researchers should consider these analytical approaches:

What are common technical challenges when working with recombinant Slc25a23 and how can they be addressed?

Researchers working with recombinant Slc25a23 frequently encounter several technical challenges:

  • Protein Solubility and Stability: As a multipass transmembrane protein localized to the mitochondrial inner membrane, Slc25a23 can be difficult to express and purify in its properly folded form.

    Solution: Consider using mammalian expression systems rather than bacterial systems, and incorporate appropriate detergents during purification to maintain protein solubility. Mild detergents like digitonin or DDM (n-dodecyl β-D-maltoside) often work well for mitochondrial membrane proteins.

  • Functional Assay Sensitivity: Detecting changes in calcium uptake requires highly sensitive methods.

    Solution: Optimize calcium indicator selection and concentration (e.g., Fura-2FF) for your specific experimental system. Calibrate your detection system carefully and use appropriate positive and negative controls. For permeabilized cell assays, ensure complete permeabilization with digitonin while maintaining mitochondrial integrity .

  • Protein-Protein Interaction Detection: Confirming interactions between Slc25a23 and MCU complex components can be challenging.

    Solution: Use epitope tags that have been validated in previous studies (e.g., Flag-tagged Slc25a23, GFP-tagged MCU, HA-tagged MICU1). Optimize immunoprecipitation conditions including lysis buffer composition, antibody concentration, and wash stringency .

  • Phenotypic Variability Between Knockdown Clones: Different shRNA constructs may yield varying levels of knockdown and phenotypic effects.

    Solution: Generate and characterize multiple independent knockdown clones. Include both complete (#864) and partial (#863) knockdown clones in analyses, as both provide valuable information about dose-dependent effects .

How can researchers optimize calcium uptake assays when studying Slc25a23 function?

Optimizing calcium uptake assays for Slc25a23 functional studies requires attention to several key parameters:

  • Buffer Composition Optimization:

    • Include succinate (typically 5 mM) to energize mitochondria

    • Add thapsigargin (1 μM) to inhibit SERCA-mediated ER calcium uptake

    • Consider phosphate concentration carefully, as Slc25a23 functions as a Mg-ATP/Pi carrier and phosphate levels (typically 300 μM) can affect experimental outcomes

  • Sequential Inhibitor Application Strategy:

    • First block calcium uptake with Ru360 (MCU inhibitor)

    • Then block calcium efflux with CGP37157 (mitochondrial Na⁺/Ca²⁺ exchanger inhibitor)

    • Finally apply CCCP (uncoupler) to release all mitochondria-stored calcium

    • This sequence allows separate measurement of influx rate, efflux rate, and total mitochondrial calcium

  • Data Analysis Considerations:

    • Calculate the slope of initial calcium uptake to determine influx rate

    • Measure the slope after Ru360 addition to determine efflux rate

    • Quantify calcium release after CCCP addition to determine total mitochondrial calcium load

    • Compare all three parameters between control and experimental conditions

  • Control Experiments:

    • Include both negative control shRNA and partial knockdown conditions

    • Test related family members (Slc25a24, Slc25a25) to establish specificity

    • Perform rescue experiments by reintroducing Slc25a23 into knockdown cells

    • Consider using specific MCU complex component knockdowns as comparison points

What strategies can improve reproducibility when investigating Slc25a23's interactions with the MCU complex?

Ensuring reproducible results when studying Slc25a23-MCU complex interactions requires systematic approaches:

  • Standardized Expression Systems:

    • Use consistent cell lines for protein expression (e.g., COS7 cells have been successfully used for co-immunoprecipitation studies)

    • Standardize transfection protocols and expression levels

    • Confirm protein expression by Western blot prior to interaction studies

  • Complementary Interaction Detection Methods:

    • Combine co-immunoprecipitation with functional assays like patch clamping

    • Consider proximity ligation assays or FRET-based approaches as alternative methods to detect protein-protein interactions

    • Validate interactions in multiple cell types, particularly those with high endogenous Slc25a23 expression (brain, heart, skeletal muscle, liver cells)

  • Controlled Experimental Conditions:

    • Standardize calcium concentrations across experiments

    • Control phosphate levels, which affect Slc25a23 function

    • Document detailed protocols including buffer compositions, incubation times, and antibody concentrations

  • Data Reporting Practices:

    • Report both positive and negative results

    • Include all control conditions in publications

    • Provide raw data traces for electrophysiological recordings

    • Quantify interaction strength rather than simply reporting presence/absence of interaction

The table below summarizes key parameters that should be standardized across experiments:

ParameterRecommended StandardizationRationale
Cell typeCOS7 or HeLa cellsSuccessfully used in previous studies
Protein tagsFlag (Slc25a23), GFP (MCU), HA (MICU1)Validated tag combinations
Lysis bufferDigitonin-based for membrane proteinsPreserves membrane protein interactions
Calcium concentration5 mM for patch clamp, 10 μM for uptake assaysOptimal for detecting differences
Phosphate levelsTest both with and without 300 μM phosphateCritical for understanding Slc25a23 function

What are key unanswered questions about Slc25a23's role in mitochondrial calcium regulation?

Despite significant advances in understanding Slc25a23's function, several important questions remain unanswered:

  • Structural Basis of Function: How do the EF-hand domains of Slc25a23 structurally change upon calcium binding, and how does this affect its interaction with MCU and MICU1? Detailed structural studies using cryo-EM or X-ray crystallography could provide insights into the conformational changes that occur when Slc25a23 binds calcium .

  • Tissue-Specific Roles: Given that Slc25a23 is highly expressed in brain, heart, skeletal muscle, liver, and small intestine, does its function vary in different tissues? Tissue-specific knockout models could help elucidate potential specialized roles in different organs .

  • Pathophysiological Relevance: How does Slc25a23 dysfunction contribute to disease states involving mitochondrial calcium dysregulation, such as neurodegenerative diseases, ischemia-reperfusion injury, or metabolic disorders? Studies in disease models could clarify its potential role in pathological conditions .

  • Regulatory Mechanisms: What factors regulate Slc25a23 expression and activity under different physiological and pathological conditions? Investigation of transcriptional, post-transcriptional, and post-translational regulation would provide insights into how cells modulate Slc25a23 function .

  • Supercomplex Organization: What is the stoichiometry and spatial organization of the proposed MCU-MICU1-Slc25a23 supercomplex? Advanced imaging techniques such as super-resolution microscopy could help visualize these complexes in intact mitochondria .

How might single-cell approaches advance our understanding of Slc25a23 function?

Single-cell methodologies offer promising approaches to address current knowledge gaps regarding Slc25a23:

  • Single-Cell Calcium Imaging: Traditional calcium uptake assays measure average responses across cell populations. Single-cell calcium imaging could reveal cell-to-cell variability in Slc25a23-mediated calcium uptake and potential subpopulations with distinct calcium handling properties.

  • Mitochondrial Heterogeneity Analysis: Single-mitochondrion patch clamp recordings could determine whether Slc25a23-MCU interactions occur uniformly across all mitochondria or preferentially in specific mitochondrial subpopulations. This approach could reveal functional heterogeneity that is masked in whole-cell or isolated mitochondria preparations .

  • Spatial Organization Studies: Super-resolution microscopy techniques combined with proximity ligation assays could map the spatial distribution of Slc25a23-MCU-MICU1 complexes within individual mitochondria, potentially revealing microdomains of calcium regulation.

  • Single-Cell Transcriptomics and Proteomics: These approaches could identify cell-to-cell variability in Slc25a23 expression levels and correlate this with expression of other mitochondrial calcium regulatory proteins, potentially revealing coordinated regulatory networks .

  • Live-Cell Dynamics: FRET-based sensors could track real-time changes in Slc25a23-MCU interactions in response to calcium signals in individual cells, providing insights into the dynamic assembly and disassembly of these complexes.

What technological advances would facilitate deeper investigation of Slc25a23's molecular mechanisms?

Advancing our understanding of Slc25a23's molecular mechanisms will require innovative technological approaches:

  • Structural Biology Techniques:

    • Cryo-electron microscopy of the Slc25a23-MCU-MICU1 complex could reveal structural details of their interaction

    • Hydrogen-deuterium exchange mass spectrometry could identify regions involved in protein-protein interactions

    • NMR studies of the EF-hand domains could characterize calcium-induced conformational changes

  • Advanced Genetic Tools:

    • CRISPR-Cas9 domain-specific editing could enable precise modification of Slc25a23's functional domains

    • Conditional knockout mouse models would allow tissue-specific and temporally controlled deletion of Slc25a23

    • AAV-mediated gene delivery could facilitate in vivo rescue experiments

  • Innovative Imaging Approaches:

    • Expansion microscopy combined with super-resolution techniques could visualize Slc25a23-MCU complexes at unprecedented resolution

    • Correlative light and electron microscopy could relate functional calcium signals to ultrastructural localization of protein complexes

    • Lattice light-sheet microscopy could track Slc25a23 dynamics in living cells with minimal phototoxicity

  • Functional Assays with Increased Sensitivity:

    • Development of Slc25a23-specific activity assays to directly measure ATP-Mg/Pi transport

    • Genetically encoded calcium indicators targeted to mitochondrial microdomains could provide spatially resolved calcium measurements

    • Multiplex assays simultaneously measuring calcium uptake, membrane potential, and ROS production could reveal functional relationships between these parameters

  • Systems Biology Approaches:

    • Network analysis integrating transcriptomic, proteomic, and functional data could reveal Slc25a23's position within broader cellular signaling networks

    • Mathematical modeling of mitochondrial calcium dynamics incorporating Slc25a23 activity could predict cellular responses to various stimuli

    • Multi-omics approaches could identify adaptive responses to Slc25a23 manipulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.