Recombinant Mouse Calcium channel flower homolog (Cacfd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cacfd1; Calcium channel flower homolog; Calcium channel flower domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cacfd1
Target Protein Sequence
MSGSGAAGAAAGPAPPAQEEGMTWWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIAAG VWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTT LLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETFEGEL
Uniprot No.

Target Background

Gene References Into Functions
  1. Studies have shown that Flower protein mutants lacking AP-2 adaptor protein binding sites fail to rescue endocytosis. This indicates that Flower protein interacts with endocytic machinery proteins to mediate granule endocytosis, establishing it as a key mediator of this process. PMID: 29288152
  2. Research suggests that skin papilloma cells utilize mFwe activity to promote clonal expansion. PMID: 22362363
Database Links
Protein Families
Calcium channel flower family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse CACFD1 protein?

Mouse CACFD1 (Flower homolog) is a 171-amino acid membrane protein containing four transmembrane domains. Hydropathy profile analysis initially predicted three to four transmembrane domains, but detailed topological studies using fluorophore tagging confirmed the four-domain structure . The protein's C-terminus and the region between the second and third transmembrane domains are located in the cytoplasm, as demonstrated through pHluorin fusion experiments where fluorescence decreased upon cytoplasmic acidification with CCCP (carbonyl cyanide m-chlorophenyl hydrazone) .

Where is mouse CACFD1 primarily localized within cells?

Mouse CACFD1 is predominantly localized to intracellular vesicles. Studies in cytotoxic T lymphocytes (CTLs) have shown that while CACFD1 is expressed in these cells, it primarily resides in vesicular structures rather than at the plasma membrane . This intracellular localization aligns with its functional role in vesicular trafficking processes, particularly in immune cells.

What are the primary biological functions of mouse CACFD1?

Mouse CACFD1 serves critical functions in calcium-dependent endocytosis, particularly in immune cells. Research demonstrates that:

  • It facilitates the endocytosis of cytotoxic granules (CGs) in CTLs in a calcium-dependent manner

  • CACFD1-deficient CTLs show complete blockage of CG endocytosis at early stages

  • The protein does not affect immunological synapse formation or exocytosis of CGs

  • Its function appears to be specifically linked to calcium-dependent recycling processes

This protein is evolutionarily related to the Drosophila Flower (fwe) gene, which functions in cell competition and fitness fingerprinting .

What approaches are effective for studying CACFD1 expression and function?

TechniqueApplicationNotes
Western BlotProtein expression analysisEffective at detecting endogenous protein; observed MW ~19 kDa
ImmunoprecipitationProtein isolation and interaction studies1:50 dilution recommended for antibodies
Total Internal Reflection Fluorescence Microscopy (TIRFM)Vesicle trafficking visualizationUsed for tracking CG dynamics in CTLs
Gene knockout modelsFunctional studiesHomologous recombination in embryonic stem cells proven effective
Fluorophore taggingTopology and localization studiespHluorin and mRFP fusion constructs useful for localization

For rigorous analysis of CACFD1 expression and function, multiple complementary techniques should be employed. Western blotting provides baseline expression data while functional assays like TIRFM can reveal dynamic processes in living cells. Knockout models are particularly valuable for determining physiological roles through loss-of-function phenotypes .

How can researchers effectively generate and validate CACFD1-deficient mouse models?

CACFD1-deficient mouse models can be generated through homologous recombination in embryonic stem cells, as demonstrated in published research . The process involves:

  • Creating a targeting construct that removes critical exons of the CACFD1 gene

  • Screening for successful recombination events through PCR and Southern blotting

  • Generating chimeric mice through blastocyst injection

  • Breeding to homozygosity and confirming knockout through both genotyping and protein expression analysis

Validation should include: (1) confirmation of gene deletion, (2) verification of protein absence via Western blot, (3) phenotypic characterization, and (4) rescue experiments with reintroduced CACFD1 to confirm specificity of observed defects .

What is the specific role of CACFD1 in cytotoxic T lymphocyte function?

CACFD1 plays a crucial and specific role in the endocytic machinery of cytotoxic T lymphocytes (CTLs). Research using CACFD1-deficient mouse models has established that:

  • CACFD1 is essential for the endocytosis of cytotoxic granules (CGs) at the immunological synapse

  • CACFD1 deficiency completely blocks CG endocytosis at early stages

  • CACFD1 does not affect formation of the immunological synapse or exocytosis of CGs

  • CACFD1 mediates the calcium-dependent step of endocytosis in CTLs

This role is particularly important for CTL function because proper recycling of CG components ensures continuous killing capacity of these immune cells. Without functional CACFD1, CTLs may experience diminished cytotoxic capacity over extended engagement with target cells due to impaired vesicle recycling .

How does CACFD1 influence calcium dynamics during immune cell activation?

Interestingly, despite its role in calcium-dependent processes, CACFD1 does not appear to directly alter global calcium dynamics in CTLs. Experiments using fura2-AM calcium imaging revealed that:

  • Resting calcium levels are comparable between wild-type and CACFD1-deficient CTLs

  • Calcium flux upon T cell receptor activation (anti-CD3 stimulation) showed identical kinetics in both wild-type and knockout cells

  • Even with elevated extracellular calcium (10 mM), calcium signals maintained indistinguishable kinetics between genotypes

This suggests that CACFD1 functions downstream of calcium signaling, sensing rather than regulating calcium levels. The protein likely acts as an effector that responds to local calcium changes to facilitate endocytosis rather than influencing the calcium signaling machinery itself .

How does mouse CACFD1 compare to its Drosophila and human counterparts?

CACFD1 exhibits significant evolutionary conservation with important functional specializations across species:

FeatureDrosophila FlowerMouse CACFD1Human CACFD1
IsoformsMultiple isoforms serving as "Win" or "Lose" signalsFull characterization of isoforms not reportedFour isoforms (hFWE1-4) with distinct functions
FunctionCell competition and fitness selectionCalcium-dependent endocytosis in immune cellsCell competition and calcium channel regulation
Disease relevanceDevelopment and tissue homeostasisImmune functionCancer progression; hFWE2/4 promote competitive growth
Expression patternFitness-dependent expressionExpressed in immune cells and other tissuesIsoform expression correlates with cell fitness

While the core molecular structure appears conserved, functional adaptations have occurred across species. The Drosophila and human proteins clearly function in cell competition, while mouse CACFD1 has been primarily characterized for its role in immune cell endocytosis .

Do mouse CACFD1 isoforms function similarly to the "Win/Lose" system described in Drosophila and humans?

The search results don't explicitly describe a "Win/Lose" system for mouse CACFD1 isoforms as documented in Drosophila and humans. In humans, hFWE1 and hFWE3 behave as "Flower-Lose" proteins indicating reduced fitness, while hFWE2 and hFWE4 function as "Flower-Win" proteins conferring competitive advantage .

While mouse CACFD1 is homologous to these proteins, current research has focused primarily on its role in immune cell endocytosis rather than cell competition. Further research is needed to determine if mouse CACFD1 isoforms play similar roles in fitness fingerprinting. If such mechanisms exist in mice, they could provide valuable insights into comparative biology and the evolution of cell competition mechanisms .

What is known about CACFD1's role in cancer and competitive cell growth?

While direct evidence for mouse CACFD1 in cancer models is limited in the provided search results, significant findings from human studies suggest important implications:

  • Human CACFD1 isoforms (hFWE2 and hFWE4) provide cells with competitive growth advantages and are overexpressed in cancer cells

  • These "Flower-Win" isoforms help cancer cells outcompete surrounding cells, potentially aiding tumor progression

  • Inhibition of CACFD1 expression reduced competitive advantages of cancer cells

The evolutionary conservation between human and mouse CACFD1 suggests similar mechanisms may operate in mouse cancer models, though specific studies in mouse systems would be needed to confirm this. The "fitness fingerprint" concept, where certain CACFD1 isoforms mark cells for elimination or preservation, provides a compelling framework for understanding how cancer cells might exploit this system .

How might CACFD1 function in neurological contexts?

CACFD1 may have important neurological functions based on its expression pattern and potential regulation:

  • In studies examining NMDA receptor function in inhibitory neurons, CACFD1 (specifically noted as Cacfd1) was identified among differentially expressed genes in the prefrontal cortex following M-8324 treatment

  • These changes were observed alongside alterations in several ion channel genes

  • The specific upregulation of CACFD1 in the prefrontal cortex but not auditory cortex suggests region-specific regulation

This differential expression pattern suggests CACFD1 may contribute to neuronal physiology in a region-specific manner. Its potential role as a calcium channel component could influence neuronal excitability, synaptic transmission, or plasticity, though detailed functional studies in neurological contexts are needed .

What is the relationship between extracellular calcium and CACFD1 function?

CACFD1 demonstrates a clear calcium-dependent functionality, particularly in the context of endocytosis:

  • In CACFD1-deficient CTLs, endocytosis of cytotoxic granules is completely blocked

  • This blockage can be fully rescued by increasing extracellular calcium concentration

  • The rescue effect suggests that CACFD1 mediates calcium-dependent steps in endocytosis

  • CACFD1 likely acts as a calcium sensor or effector rather than a regulator of calcium signaling

This relationship parallels the function of Drosophila Flower in synaptic vesicle endocytosis, suggesting evolutionary conservation of calcium-dependent trafficking mechanisms. Researchers investigating CACFD1 should consider calcium concentration as a critical variable in experimental designs, particularly when studying vesicular trafficking processes .

What methodological approaches are recommended for identifying CACFD1 protein interactions?

For investigating CACFD1 protein interactions, researchers should consider multiple complementary approaches:

MethodApplicationAdvantages
ImmunoprecipitationDirect protein binding partnersWorks with endogenous protein; antibodies available at 1:50 dilution
Proximity labeling (BioID, APEX)Spatial protein associationsCaptures transient interactions; works in native cellular environment
Fluorescence resonance energy transfer (FRET)Direct protein-protein interactionsAllows live-cell visualization of interactions
Mass spectrometry following crosslinkingComprehensive interactome analysisIdentifies multiple interaction partners simultaneously
Yeast two-hybrid screeningBinary protein interactionsUseful for initial screening of potential interactors

When conducting these studies, researchers should consider the membrane topology of CACFD1, with its four transmembrane domains and cytoplasmic regions between the second and third transmembrane domains and at the C-terminus, as these accessible regions are likely interaction sites for cytoplasmic binding partners .

What are the most promising areas for future CACFD1 research?

Several high-potential research directions emerge from current understanding of CACFD1:

  • Isoform-specific functions: Investigating whether mouse CACFD1 expresses multiple isoforms with distinct functions similar to human and Drosophila homologs

  • Cell competition in development and disease: Exploring CACFD1's potential role in cell competition mechanisms in mouse development and disease models

  • Therapeutic targeting: Examining whether modulation of CACFD1 function could impact disease processes, particularly in immune disorders or cancer

  • Structural biology: Determining the three-dimensional structure of CACFD1 to understand its calcium-sensing mechanism

  • Tissue-specific functions: Expanding studies beyond immune cells to understand CACFD1's role in other tissues, including neuronal contexts

Each of these directions could significantly advance understanding of this evolutionarily conserved protein and potentially reveal new therapeutic targets for diseases involving cell competition, calcium signaling, or membrane trafficking.

What experimental approaches would best elucidate CACFD1's calcium-sensing mechanism?

To investigate how CACFD1 senses calcium and regulates endocytosis, researchers should consider:

  • Structure-function analysis: Creating targeted mutations in potential calcium-binding domains followed by functional rescue experiments

  • Calcium imaging with subcellular resolution: Employing genetically-encoded calcium indicators fused to CACFD1 to monitor local calcium dynamics during endocytosis

  • In vitro binding assays: Using purified CACFD1 protein domains to directly measure calcium binding affinities and kinetics

  • Cryo-electron microscopy: Resolving the three-dimensional structure of CACFD1 in calcium-bound and unbound states

  • Optogenetic manipulation: Using light-activated calcium channels to precisely control local calcium levels while monitoring CACFD1-dependent processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.