Recombinant Mouse Calnexin (Canx)

Shipped with Ice Packs
In Stock

Description

Expression and Production

Recombinant mouse calnexin is typically produced in mammalian expression systems (e.g., HEK293 cells) to ensure proper post-translational modifications. Key production steps include:

  • Cloning: A DNA sequence encoding Met1-Pro482 is inserted into mammalian expression vectors .

  • Purification: Affinity chromatography using His-tag binding .

  • Quality Control: SDS-PAGE and Western blot confirm purity (>90%) and correct molecular weight .

Table 3: Key Research Findings

Model/StudyKey FindingsSource
EAE in MiceCalnexin deficiency → Resistance to EAE; reconstitution restores susceptibility
ER StressLoss of calnexin exacerbates ER stress in cardiomyocytes
Synaptic FunctionLinked to receptor-mediated endocytosis at synapses

Applications in Research

Recombinant mouse calnexin is utilized in:

  • Biochemical Assays: SDS-PAGE and Western blot to study protein interactions .

  • Immunoprecipitation: Identifying binding partners in glycoprotein folding .

  • In Vivo Models: Exploring calnexin’s role in autoimmune diseases (e.g., EAE) and neurodegeneration .

Challenges and Considerations

  • Species Specificity: Human and mouse calnexin share 85% sequence identity, but functional differences necessitate species-specific studies .

  • Tag Impact: C-terminal His-tags may alter protein localization or function in some assays .

  • Storage: Requires -20°C storage to maintain activity; repeated freeze-thaw cycles degrade purity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Canx; Calnexin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-591
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDEEEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
Uniprot No.

Target Background

Function

Calnexin is a calcium-binding protein that interacts with newly synthesized glycoproteins within the endoplasmic reticulum (ER). Its functions include assisting protein assembly and retaining unassembled protein subunits in the ER. It plays a crucial role in ER quality control by retaining misfolded proteins. Calnexin is also associated with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes, suggesting a role in signaling complex regulation and thymocyte maturation. Furthermore, it may participate in receptor-mediated endocytosis at the synapse.

Gene References Into Functions
  1. CNX plays a specific role in cardiomyocyte viability and Ca2+ cycling by influencing ER stress, apoptosis, and Ca2+ channel expression. PMID: 24037923
  2. Calnexin distinguishes between different conformational states of GlyT2, exhibiting lectin-independent chaperone activity. PMID: 23650557
  3. Calnexin and ERp57, but not calreticulin, significantly impact the biology of peripheral myelin proteins PMP22 and P0, potentially contributing to peripheral neuropathy pathogenesis. PMID: 21831887
  4. Increased clathrin-dependent endocytosis in the absence of calnexin may contribute to the neurological phenotype observed in calnexin-deficient mice. PMID: 21747946
  5. The E351 mutation slightly enhances ERp57 binding to calnexin, while W428 significantly increases this interaction. PMID: 20385098
  6. Adam7 may function in fertilization by forming a complex with heat shock protein 5, calnexin, and Itm2b during sperm capacitation. PMID: 20945367
  7. Endoplasmic reticulum stress affects group VIA phospholipase A2 in beta cells, influencing tyrosine phosphorylation and association with calnexin. PMID: 20732873
  8. Calnexin deficiency results in dysmyelination. PMID: 20400506
  9. CyCAP regulates tissue transglutaminase post-translational modification through colocalization with calnexin in the ER. PMID: 20049854
  10. Association with mutant peripheral myelin protein-22 ex vivo suggests a basis for "gain-of-function" ER diseases. PMID: 12119418
  11. Calnexin is essential for myelinated motor neuron function and postnatal survival in mice. PMID: 12370287
  12. Caspase-3 or caspase-7 cleaves calnexin; its cleaved product attenuates apoptosis. PMID: 15598898
  13. In mice, a calnexin-glycan interaction may stabilize the weak association of MHC class I heavy chain with β2-microglobulin in the ER until peptide binding. PMID: 16002696
  14. UGT1 activity may be necessary for structural maturation, enabling substrate dissociation from calnexin and ER export. PMID: 17643373
  15. Calnexin may stimulate the productive folding of wild-type CFTR, but not ΔF508 CFTR, which has folding defects. PMID: 18457676
  16. Cnx-/- cells exhibit significantly increased proteasomal activity, potentially involved in adaptive mechanisms addressing acute ER stress in the absence of calnexin. PMID: 18528784
  17. Mammalian rod opsin biogenesis does not appear to require Cnx. PMID: 19116670
  18. ERp57 does not require interactions with calnexin and calreticulin to promote class I histocompatibility molecule assembly and enhances peptide loading independently of its redox activity. PMID: 19196713
Database Links
Protein Families
Calreticulin family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Melanosome.

Q&A

What is mouse Calnexin and what are its primary functions?

Calnexin is a 90kDa calcium-binding protein primarily localized in the endoplasmic reticulum (ER). It plays several critical roles in cellular function:

  • Interacts with newly synthesized glycoproteins in the endoplasmic reticulum

  • Assists in proper protein folding and assembly of protein complexes

  • Functions in the ER quality control apparatus by retaining incorrectly folded proteins

  • May play a role in receptor-mediated endocytosis at the synapse

  • Associates with partial T-cell antigen receptor complexes that escape the ER of immature thymocytes

Recombinant mouse Calnexin maintains these functional properties while allowing for controlled experimental manipulations in research settings .

How do I confirm the expression and functionality of recombinant mouse Calnexin?

Verification of recombinant mouse Calnexin expression and functionality can be performed through multiple complementary techniques:

  • Western Blot Analysis: Use anti-CANX antibodies to detect the expressed protein at the expected molecular weight (90kDa). This can be performed in various mouse cell lysates such as HeLa or MCF-7 .

  • Immunofluorescence: Confocal immunofluorescence imaging using specific anti-CANX antibodies can confirm cellular localization in the ER compartment .

  • Functional Assays: Assess the ability of recombinant Calnexin to bind calcium and interact with glycoproteins, which are hallmark functions.

  • SDS-PAGE: Verify purity and integrity of the recombinant protein through gel electrophoresis .

What experimental models are appropriate for studying Calnexin function?

Several experimental models have proven valuable for Calnexin research:

  • Mouse Models: Full Calnexin knockout mice (Canx -/-) and conditional knockout models (using Cre-lox system) provide valuable insights into tissue-specific roles .

  • Cell Culture Systems: Brain endothelial cell lines (bEND.3), CHO cells expressing various constructs, and neuronal cultures from wild-type and Calnexin-deficient mice are widely used .

  • Reconstitution Models: Canx -/- mice reconstituted with a transgene (Tg-CanxFL) expressing full-length calnexin protein offer a system to validate phenotype rescue .

  • Tissue-Specific Knockout Models: Models such as Canx fl/fl/Lck-Cre+ mice with T-cell specific Calnexin deletion enable cell-type specific functional studies .

How does recombinant mouse Calnexin influence protein quality control in experimental autoimmune encephalomyelitis (EAE) models?

Calnexin plays a crucial role in EAE pathophysiology through mechanisms that extend beyond traditional protein quality control:

  • Global deletion of Calnexin in mice (Canx -/-) confers resistance to EAE induction, with no evidence of immune cell infiltration into the CNS or induction of inflammatory markers .

  • This protective effect is not due to alterations in immune system development or function, as Calnexin-deficient mice have normal immune system development .

  • The mechanism appears to involve blood-brain barrier function, as loss of Calnexin leads to defects in brain endothelial cell function resulting in reduced T cell trafficking across the blood-brain barrier .

  • Importantly, when recombinant full-length Calnexin protein is expressed in Calnexin-deficient mice (Canx -/--Tg-CanxFL), susceptibility to EAE is restored, confirming the specific role of Calnexin .

  • Tissue-specific deletion studies show that Calnexin deficiency in T cells specifically (Canx fl/fl/Lck-Cre+ mice) does not protect against EAE, indicating the critical role is at the blood-brain barrier level rather than in T cells themselves .

What methodological approaches should be used to study the interaction between recombinant mouse Calnexin and misfolded proteins?

Investigating Calnexin-misfolded protein interactions requires sophisticated approaches:

  • Co-immunoprecipitation (Co-IP): This technique effectively demonstrates the interaction between Calnexin and misfolded proteins such as ΔF508 CFTR. Increased interaction can be observed upon Calnexin overexpression .

  • Pulse-Chase Analysis: This method quantifies the effect of Calnexin on protein degradation kinetics. For example, Calnexin overexpression can partially attenuate the degradation of immature ΔF508 CFTR and prolong its half-life from approximately 45 minutes to 90 minutes .

  • Confocal Microscopy: Fluorescence microscopy using GFP-tagged misfolded proteins (e.g., ΔF508 CFTR-GFP) and fluorescently labeled anti-Calnexin antibodies can visualize their co-localization in inclusion body-like structures .

  • Proteasomal Inhibition Assays: Using inhibitors such as MG-132 in conjunction with Calnexin overexpression can help understand how Calnexin affects aggresome formation and protein ubiquitination .

How can the endocytotic function of Calnexin be properly assessed in neuronal systems?

Evaluating Calnexin's role in endocytosis requires specialized experimental approaches:

  • Transferrin Uptake Assays: This method effectively measures clathrin-dependent endocytosis in neuronal cells. Calnexin-deficient granule cells show enhanced transferrin uptake compared to wild-type cells .

  • Rescue Experiments: Expression of full-length Calnexin in Calnexin-deficient cells can restore normal endocytotic activity, confirming the specific role of Calnexin in this process .

  • Protein Interaction Studies: Molecular analysis of the interaction between Calnexin's C-terminal tail and endocytosis-related proteins like SGIP1 (SH3-domain GRB2-like endophilin-interacting protein 1) provides mechanistic insights .

  • Primary Neuronal Cultures: Isolating cerebellar granule cells from wild-type and Calnexin-deficient mice provides a physiologically relevant system to study Calnexin's role in neuronal endocytosis .

What controls should be included when using recombinant mouse Calnexin in experimental systems?

Rigorous experimental design requires proper controls:

  • Expression Level Controls: When overexpressing Calnexin, use varying multiplicities of infection (MOI) to establish dose-dependent effects. Western blotting should confirm expression levels .

  • Genetic Controls: Include heterozygous mice (Canx +/-) alongside wild-type and knockout models to assess gene dosage effects .

  • Reconstitution Controls: Use Canx -/- mice reconstituted with recombinant full-length Calnexin (Tg-CanxFL) to confirm that observed phenotypes are directly attributable to Calnexin deficiency .

  • Cell Type-Specific Controls: When studying tissue-specific effects, generate and validate appropriate conditional knockout models (e.g., Canx fl/fl/Lck-Cre+ for T cell-specific deletion) .

  • Functional Validation: Conduct conduction velocity analyses of peripheral motor and sensory axons to verify normal motor function phenotype in reconstituted models .

How should researchers interpret conflicting data regarding Calnexin function in different experimental systems?

Resolving contradictory findings requires careful analysis:

  • Cell Type Specificity: Calnexin may have different functions in different cell types. For instance, while Calnexin deficiency in T cells does not affect EAE susceptibility, global Calnexin knockout confers resistance to EAE by affecting brain endothelial cell function .

  • Protein-Specific Effects: Calnexin interacts differently with various client proteins. For example, it has distinct effects on wild-type CFTR versus ΔF508 CFTR .

  • Temporal Considerations: The effect of Calnexin may vary depending on the developmental stage or disease progression. Cytokine-stimulated brain endothelial cells show increased Calnexin expression compared to unstimulated cells .

  • Quantitative Analysis: Use quantitative methods such as pulse-chase experiments with proper statistical analysis to accurately assess Calnexin's effects on protein half-life and stability .

What are the common technical challenges when working with recombinant mouse Calnexin and how can they be addressed?

Researchers frequently encounter several challenges:

  • Protein Solubility: As an ER membrane protein, recombinant Calnexin may have solubility issues. Solution: Use appropriate detergents or express soluble domains separately.

  • Functional Assessment: Confirming that recombinant Calnexin retains native functionality can be difficult. Solution: Perform rescue experiments in Calnexin-deficient systems to verify function .

  • Specificity of Effects: Determining whether observed effects are directly due to Calnexin or secondary consequences. Solution: Use multiple complementary approaches including genetic models, reconstitution experiments, and acute manipulations .

  • Quantification Methods: Accurately measuring Calnexin's effects on protein trafficking and degradation. Solution: Employ pulse-chase analysis with appropriate statistical methods and image analysis software such as Fluoview (version 3.3) for fluorescence intensity quantification .

How can researchers effectively analyze the dynamic interactions between recombinant mouse Calnexin and client proteins?

Dynamic protein-protein interactions require specialized approaches:

  • Live Cell Imaging: Use fluorescently tagged Calnexin and client proteins to monitor their interactions in real-time, revealing temporal dynamics of association and dissociation.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can assess the mobility and exchange rates of Calnexin-client protein complexes in living cells .

  • Time-Course Experiments: Monitor the formation of Calnexin-containing structures over time, as demonstrated in studies of inclusion body-like structure formation following Calnexin overexpression .

  • Quantitative Co-localization Analysis: Use appropriate software to calculate correlation coefficients between Calnexin and client protein signals in microscopy images.

What statistical approaches are most appropriate for analyzing Calnexin-related experimental data?

  • For Survival Data: In EAE studies with Canx knockout mice, Kaplan-Meier survival analysis with log-rank tests are appropriate for comparing disease progression between experimental groups .

  • For Protein Half-life Analysis: In pulse-chase experiments, non-linear regression analysis should be applied to calculate protein half-lives accurately. The intensity of protein bands should be quantified using appropriate software (e.g., Image Gauge software version 3.4) .

  • For Microscopy Data: Quantitative analysis of fluorescence intensities in photobleached regions should be performed using specialized software (e.g., Fluoview software version 3.3), followed by appropriate statistical tests to compare experimental groups .

  • For Phenotypic Assessments: When quantifying phenomena like aggresome formation, calculate the percentage of cells displaying the phenotype across multiple fields and compare between conditions using appropriate statistical tests .

How can researchers distinguish between direct and indirect effects of Calnexin on cellular processes?

This critical distinction requires methodical approaches:

  • Temporal Analysis: Determine the sequence of events following Calnexin manipulation to identify primary versus secondary effects.

  • Domain-Specific Mutations: Use recombinant Calnexin with mutations in specific functional domains to identify which aspects of Calnexin function are responsible for observed effects.

  • Protein Interaction Network Analysis: Combine co-immunoprecipitation with mass spectrometry to identify the complete interactome of Calnexin under different conditions.

  • Comparative Studies: Compare the effects of Calnexin manipulation with those of other ER chaperones to identify unique versus general chaperone effects. For example, comparing Calnexin effects on CFTR processing with those of other ER quality control proteins .

How can findings from recombinant mouse Calnexin studies be translated to human disease models?

Bridging the gap between mouse models and human applications:

  • Comparative Expression Analysis: Compare Calnexin expression patterns between mouse models and human tissues, particularly in disease states such as multiple sclerosis where Calnexin is highly abundant in human brain endothelial cells of MS patients .

  • Therapeutic Target Validation: Assess whether manipulation of Calnexin levels or function in human cells recapitulates effects observed in mouse models, particularly regarding protein quality control and blood-brain barrier function .

  • Disease-Specific Models: Develop humanized mouse models expressing human variants of Calnexin to better model human disease conditions.

  • Cross-Species Validation: Confirm that molecular mechanisms identified in mouse studies (e.g., Calnexin's role in protein folding and trafficking) operate similarly in human cellular systems.

What are the implications of Calnexin research for developing therapeutic approaches for neurodegenerative and inflammatory diseases?

Calnexin research offers several promising therapeutic avenues:

  • Blood-Brain Barrier Modulation: Since Calnexin deficiency protects against EAE by affecting blood-brain barrier function, therapeutics targeting Calnexin in brain endothelial cells might reduce pathological immune cell infiltration in multiple sclerosis .

  • Protein Misfolding Diseases: Understanding how Calnexin modulates the folding and degradation of proteins like CFTR could inform therapeutic strategies for diseases characterized by protein misfolding, such as cystic fibrosis .

  • Neurological Disorders: Given Calnexin's role in neuronal endocytosis, therapies targeting this function might be relevant for neurological conditions involving abnormal endocytosis .

  • Combined Approaches: Therapeutic strategies might involve multiple targets within the ER quality control system, with Calnexin representing one component of a broader approach to modulating protein homeostasis in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.