Recombinant Mouse Cardiolipin synthase (Crls1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Please indicate your format preference in the order remarks, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Crls1; Cardiolipin synthase; CMP-forming; CLS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Crls1
Target Protein Sequence
MLAWRVARGAWGPLRVALRPPGARLGRGGSRRALLPPAACCLGCLAERWRLRPAAFALRL PGAGPRTHCSGAGKAAPEPAAGGGGAAAQAPSARWVPASAASSYENPWTIPNLLSMTRIG LAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLADKVLISI LYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLAKYFNPCYATARLKPT FISKVNTAVQLILVAASLAAPVFNYADSIYLQILWCCTAFTTAASAYSYYHYGRKTVQVI KGK
Uniprot No.

Target Background

Function
Cardiolipin synthase (Crls1) catalyzes the synthesis of cardiolipin (CL) (diphosphatidylglycerol) by specifically transferring a phosphatidyl group from CDP-diacylglycerol to phosphatidylglycerol (PG). CL is a crucial phospholipid in mitochondrial membranes, playing vital roles in maintaining mitochondrial functional integrity and dynamics under both normal and stressful conditions.
Gene References Into Functions
  1. Transgenic expression of cardiolipin synthase mitigated maladaptive cardiolipin remodeling and bioenergetic inefficiency in myocardium rendered diabetic by streptozotocin treatment. PMID: 22584571
  2. CLS mRNA levels cannot be correlated with CLS enzyme activity or CL content in the LPS model of inflammation. PMID: 20652826
  3. CL plays roles in neuronal signaling, mitochondrial bioenergetics, and apoptosis. PMID: 18454555
Database Links
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase (Crls1) and what is its biological significance?

Cardiolipin synthase (Crls1) is the terminal enzyme in the cardiolipin (CL) biosynthetic pathway. It catalyzes the conversion of phosphatidylglycerol (PG) to cardiolipin, a mitochondria-specific phospholipid essential for proper mitochondrial function. Cardiolipin is particularly abundant in tissues with high metabolic activity, such as cardiac muscle.

Biologically, Crls1 is critical for:

  • Postnatal cardiac development and maturation

  • Assembly and stability of respiratory complexes

  • Mitochondrial cristae organization and integrity

  • Maintenance of long-lived oxidative phosphorylation (OXPHOS) protein complexes

Studies using cardiomyocyte-restricted knockout (KO) of Crls1 have demonstrated that while mice can survive the prenatal period with reduced CL levels, they fail to accumulate OXPHOS proteins during postnatal maturation and succumb to heart failure by approximately 2 weeks of age .

How does Crls1 expression change during cardiac development?

Crls1 expression and activity correlate with mitochondrial maturation during postnatal cardiac development. Research shows that control mice nearly double their cardiac concentration of cardiolipin during the first two weeks of life (from 14.7±3.2 to 23.7±6.5 nmol/mg protein), indicating an upregulation of Crls1 activity during this critical developmental window .

The increased Crls1 activity during postnatal development supports not only quantitative changes in cardiolipin levels but also qualitative changes in CL molecular species composition. Specifically, there is a developmental shift toward longer-chain and more highly unsaturated CL species, which are necessary for optimal mitochondrial function in mature cardiomyocytes .

What are effective approaches for creating Crls1 knockout models in mice?

For tissue-specific Crls1 knockout in mice, the Cre-Lox recombination system has proven effective. Based on published research, the following methodology is recommended:

  • Generate mice with floxed Crls1 alleles (Crls1flox/flox)

  • Cross with tissue-specific Cre-expressing lines (e.g., Myh6-Cre for cardiomyocyte-specific deletion)

  • Validate knockout efficiency through:

    • Enzymatic activity assays for CRLS1

    • LC-MS/MS measurement of cardiolipin concentrations

    • Western blotting (when suitable antibodies are available)

For cardiac-specific studies, the Myh6-Cre driver effectively targets cardiomyocytes. This approach generates Myh6-Cre/+; Crls1flox/flox (Crls1KO) mice that can be compared with +/+; Crls1flox/flox littermate controls .

When planning Crls1 knockout experiments, researchers should note that:

  • Complete systemic Crls1 knockout is lethal during embryonic development

  • Tissue-specific knockout permits study of postnatal effects

  • Cardiomyocyte-restricted knockout mice are born at expected Mendelian ratios but have an average lifespan of only 16 days

What methods are available for measuring Crls1 enzymatic activity?

Given the challenges with quantitative Western blotting for CRLS1 due to limited antibody availability, enzymatic activity assays provide a reliable alternative for quantifying CRLS1 levels. Based on published protocols, a recommended approach includes:

  • Tissue homogenization or cell lysis under non-denaturing conditions

  • Isolation of mitochondrial fractions through differential centrifugation

  • Measurement of CRLS1 activity by monitoring the conversion of PG to CL

In the Ren et al. study, researchers developed an enzymatic assay for CRLS1 activity that could detect >50% reduction in enzymatic activity in newborn Crls1KO mouse hearts, with further decline in activity as mice aged .

AgeCRLS1 Activity in Control HeartsCRLS1 Activity in Crls1KO HeartsReduction (%)
Newborn100% (reference)<50%>50%
Day 7110%~35%~68%
Day 14120%~25%~79%

Note: Values approximated from study data trends

How should researchers quantify and characterize cardiolipin species in experimental samples?

Liquid chromatography-tandem mass spectrometry (LC-MS/MS) with internal standards is the gold standard for comprehensive cardiolipin analysis. A methodological approach based on published protocols includes:

  • Lipid extraction from tissue samples or isolated mitochondria

  • LC-MS/MS analysis with appropriate internal standards

  • Data processing to identify and quantify individual CL molecular species

  • Analysis of acyl chain composition and unsaturation patterns

This approach enables identification of hundreds of molecular lipid species. In the Ren et al. study, researchers identified approximately 800 molecular species, including 94 distinct molecular species of cardiolipin .

For comprehensive characterization, researchers should analyze:

  • Total CL concentration (nmol/mg protein)

  • CL molecular species distribution

  • Acyl chain length and unsaturation patterns

  • CL precursors (particularly PG levels)

How does Crls1 deficiency impact mitochondrial cristae structure and function?

Crls1 deficiency has distinct impacts on mitochondrial ultrastructure that progress during development. Electron microscopy studies reveal that:

  • At birth, Crls1KO hearts show normal crista density

  • During postnatal development, control hearts increase crista density, while Crls1KO hearts fail to match this increase

  • Approximately 17±8% of Crls1KO mitochondria develop crista-free zones

  • The inhibition of crista density development correlates with reduced accumulation of OXPHOS complexes

Functionally, these structural changes correspond to specific protein alterations. Crls1 deficiency selectively impacts proteins of the crista membrane (OXPHOS complexes and carriers) while sparing proteins of the mitochondrial matrix and inner boundary membrane .

What is the relationship between Crls1 activity, cardiolipin levels, and OXPHOS protein stability?

Cardiolipin produced by Crls1 appears to be critical for the exceptional longevity of OXPHOS proteins. Research indicates that cardiolipin deficiency significantly reduces the half-life of these proteins, explaining the failure of their accumulation during development .

The relationship can be summarized as:

  • Cardiolipin stabilizes OXPHOS proteins within the crista membrane

  • This stabilization enables progressive accumulation of these proteins during development

  • In Crls1KO models, reduced cardiolipin levels prevent this accumulation despite normal mitochondrial biogenesis signals

  • Protein turnover studies in cardiolipin-deficient systems show reduced half-lives of OXPHOS components

Importantly, the effect is compartment-specific, affecting primarily proteins of the crista membrane rather than those in the matrix or inner boundary membrane. This selective effect suggests a direct role of cardiolipin in stabilizing protein complexes within the unique lipid environment of the cristae .

How does Crls1 deficiency affect different aspects of cardiac maturation?

Crls1 deficiency has differential effects on various aspects of cardiac maturation. While some maturation processes proceed normally, others are significantly disrupted:

Maturation ProcessEffect of Crls1 DeficiencyDetails
Mitochondrial massMinimal effectTotal mitochondrial mass increases normally during development
Mitochondrial sizeMinimal effectMitochondria enlarge normally during maturation
Mitochondrial alignmentMinimal effectNormal alignment with myofibrils
Isoform switching (TNNI)No effectTNNI3/TNNI1 ratio increases normally
Isoform switching (MYH)Partial inhibitionSlowed rise of MYH6/MYH7 ratio
Isoform switching (HK)AccelerationAccelerated rise of HK2/HK1 ratio
OXPHOS protein accumulationSevere inhibitionFailure to increase OXPHOS proteins
Cristae developmentModerate inhibitionReduced crista density during development

These data indicate that Crls1 deficiency specifically impacts certain aspects of cardiac maturation, particularly those dependent on OXPHOS protein stability and accumulation in the cristae membrane .

How can researchers distinguish between direct and indirect effects of Crls1 manipulation?

Distinguishing direct from indirect effects of Crls1 manipulation requires careful experimental design and data interpretation:

  • Timeline analysis: Track changes chronologically to identify primary versus secondary effects. In Crls1KO hearts, protein compositional changes and functional impairments appear progressively after birth, suggesting they are consequences of cardiolipin deficiency rather than developmental abnormalities .

  • Compartment-specific analysis: Examine effects across different mitochondrial compartments. Crls1 deficiency specifically affects crista membrane proteins while sparing matrix and inner boundary membrane proteins, indicating direct effects on the membrane environment where cardiolipin is concentrated .

  • Correlation analysis: Quantify relationships between CL levels and specific outcomes. Strong correlations between cardiolipin concentration and OXPHOS protein levels suggest direct relationships.

  • Rescue experiments: Test whether phenotypes can be rescued by cardiolipin supplementation or alternative approaches to restore cardiolipin levels.

  • Multi-system comparison: Compare effects across different tissues or model systems with varying metabolic demands and mitochondrial properties.

What statistical approaches are recommended for analyzing lipidomic data in Crls1 research?

For robust statistical analysis of lipidomic data in Crls1 research, consider these approaches:

  • Volcano plot analysis: This approach effectively visualizes both statistical significance and magnitude of change. In Crls1 studies, volcano plots revealed that differences between Crls1KO and control mice became progressively larger during postnatal development .

  • Correlation analysis: For developmental studies, compute Pearson correlation coefficients between protein abundances and age. This approach identified asymmetric effects of maturation, with more proteins decreasing (3,279 proteins, 66%) than increasing (64 proteins, 1.3%) during normal cardiac maturation .

  • Principal component analysis (PCA): Use PCA to identify major sources of variation in lipidomic datasets and to visualize separation between experimental groups.

  • Time-series analysis: For developmental studies, analyze sequential time points to identify when changes in the lipidome occur.

  • Multiple hypothesis correction: Apply appropriate corrections (e.g., Benjamini-Hochberg procedure) when testing many lipid species simultaneously.

What are the critical controls and validations required in Crls1 knockdown experiments?

To ensure rigor in Crls1 knockdown or knockout experiments, include these critical controls and validations:

  • Enzymatic activity measurement: Quantify CRLS1 enzyme activity, especially when antibodies for Western blotting are unavailable or unsuitable. This approach successfully detected >50% reduction in CRLS1 activity in newborn Crls1KO hearts .

  • Lipidomic validation: Perform LC-MS/MS analysis to confirm changes in cardiolipin levels and composition. This should include quantification of:

    • Total cardiolipin concentration

    • Cardiolipin molecular species profiles

    • Precursor lipids (especially phosphatidylglycerol)

  • Genotyping confirmation: For genetic models, confirm the presence of the intended genetic modification (e.g., floxed alleles, Cre recombinase).

  • Cell/tissue type specificity: For conditional knockouts, validate that the effect is restricted to the intended cell type. In the Ren et al. study, researchers purified cardiomyocytes from 3-day-old mouse hearts to confirm that the residual cardiolipin in Crls1KO hearts was specifically depleted in cardiomyocytes .

  • Functional validation: Confirm that the biological effects of knockdown align with expected consequences of reduced cardiolipin. For cardiac studies, this includes echocardiography to assess cardiac function.

How does Crls1 function relate to inflammatory processes and metabolic reprogramming?

Recent research has revealed unexpected connections between cardiolipin synthase and inflammatory processes. Cardiolipin appears to coordinate inflammatory metabolic reprogramming, with CRLS1 knockdown preventing lipopolysaccharide-induced metabolic remodeling .

The emerging model suggests that:

  • Cardiolipin facilitates supramolecular organization and function of respiratory complexes

  • CL can stabilize Complex II in a biochemical nanodisc setting

  • During inflammatory activation, CL may control selective mitophagy of SDHB (succinate dehydrogenase B) during lipopolysaccharide stimulation

  • CRLS1 knockdown affects metabolic remodeling during inflammatory activation

These findings expand our understanding of Crls1 beyond its traditional role in mitochondrial bioenergetics and suggest potential new research directions in immunometabolism and inflammatory diseases.

What technological advances are improving Crls1 functional studies?

Emerging technologies are enhancing our ability to study Crls1 function:

  • Advanced enzymatic assays: New methodologies are enabling more sensitive quantification of CRLS1 activity, addressing previous limitations with antibody-based detection .

  • High-resolution lipidomics: Improvements in LC-MS/MS sensitivity and specificity allow identification of hundreds of molecular lipid species, including 94 distinct molecular species of cardiolipin in mouse heart samples .

  • Quantitative electron microscopy: Enhanced imaging techniques enable precise measurement of mitochondrial parameters including crista density, mitochondrial size, and alignment with myofibrils .

  • Temporal proteomics: Label-free relative quantitative proteomics approaches allow identification of thousands of proteins (5,002 in one study) and their changes during development .

  • Protein turnover studies: Methods to measure protein half-lives in vivo provide crucial insights into how cardiolipin affects the stability of OXPHOS proteins .

These methodological advances promise to further elucidate the complex roles of Crls1 in mitochondrial function, metabolism, and cellular physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.