Recombinant Mouse CD82 antigen (Cd82)

Shipped with Ice Packs
In Stock

Description

Applications in Research

Recombinant mouse CD82 is widely used in in vitro and in vivo studies to investigate its biological roles. Below are key applications:

Functional Assays

  • Cell Adhesion and Migration: CD82 inhibits integrin-mediated adhesion and migration by regulating integrin αβ1 and avβ5 .

  • Immune Modulation: Recombinant CD82 suppresses phagocyte migration into inflamed tissues and modulates cytokine production (e.g., TNF-α, IL-1β) .

  • Antifungal Defense: CD82 organizes Dectin-1 into signaling domains, enhancing fungal pathogen recognition and ROS production .

Detection and Analysis

Recombinant CD82 serves as a standard in antibody validation and protein interaction studies.

Antibody ProductCloneApplicationsSpecies ReactivitySource
Mouse IgG2a (5D5D5)5D5D5ELISA, WB, IHC, FCMouse, Human
Rabbit IgG (EPR4112)EPR4112WB, IHC-PHuman
PE-conjugated (ASL-24)ASL-24Flow CytometryHuman, Primate

Neuroprotection and Axonal Transport

In glaucoma models, CD82 overexpression via adeno-associated virus (AAV) vectors protects retinal ganglion cells (RGCs) by activating the mTOR pathway and reducing β-amyloid (Aβ) accumulation . Recombinant CD82 may enhance these effects by stabilizing axonal transport mechanisms.

Key Outcomes:

  • Reduced Axonal Degeneration: CD82 overexpression restored axonal transport deficits in acute ocular hypertension models .

  • Aβ Clearance: Lower Aβ immunoreactivity observed in CD82-treated optic nerves .

Immune Regulation

CD82 modulates phagocytic cell behavior and pathogen survival:

  • Phagocyte Migration: CD82-deficient mice show increased neutrophil/macrophage infiltration into inflamed tissues .

  • Tuberculosis Pathogenesis: CD82 hypomethylation in macrophages promotes MTB survival by arresting phagosome maturation via RUNX1-Rab5/22 interaction .

Therapeutic Implications

Recombinant CD82 shows promise in treating diseases involving immune dysregulation, neurodegeneration, and fibrosis:

Disease ModelPotential ApplicationEvidence
GlaucomaNeuroprotection via axonal transport enhancementCD82 overexpression reduces RGC loss .
Fungal InfectionsAntifungal immunity boosterCD82 knockout mice show impaired Dectin-1 signaling .
Cancer MetastasisSuppression of tumor cell migrationCD82 overexpression inhibits lung metastasis .

Limitations and Future Directions

  • Species-Specific Variations: Human CD82 studies dominate; mouse-specific recombinant products require further characterization .

  • Epigenetic Regulation: CD82 hypomethylation in tuberculosis highlights the need to study DNA methylation in CD82-based therapies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Cd82; Kai1CD82 antigen; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1 homolog; CD antigen CD82
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKNSFISVLQTSSSSLQVGAYVFI GVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNT VMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIK EEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVI ELLGLFLSICLCRYIHSEDYSKVPKY
Uniprot No.

Target Background

Function
CD82 associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.
Gene References Into Functions
  1. CD82 serves as a functional surface marker of long-term repopulating hematopoietic stem cells (LT-HSCs) that maintains quiescence through interaction with DARC-expressing macrophages within the bone marrow stem cell niche. PMID: 26996598
  2. Loss of Kai1 expression is linked to neoplasm metastasis. PMID: 23401136
  3. The synergistic effects of CD82 and GM3 or GM2/GM3 ganglioside on EGFR expression and phosphorylation and cMet activation are responsible for CD82 inhibition of EGF- and HGF-dependent cell motility and migration in Hepa1-6 cells. PMID: 23968914
  4. The tetraspanin CD82 is specifically recruited to pathogen-containing phagosomes before fusion with lysosomes. PMID: 21149584
  5. KAI1 plays a role in promoting cell proliferation and mammary gland hyperplasia through the gp78 ubiquitin ligase. PMID: 20089858
  6. Hypoxia-dependent induction of KAI1 is directly mediated by hypoxia-inducible factor-1alpha binding on the promoter, leading to increased recruitment of RNA polymerase II for transcriptional activation. PMID: 20123085
  7. An antibody that specifically detects murine Kai1/CD82 should prove useful in elucidating the mechanism of action of Kai1 in metastatic suppression. PMID: 16372335
  8. gp78 promotes sarcoma metastasis by targeting KAI1 for degradation. PMID: 18037895
  9. The transgenic adenocarcinoma of mouse prostate model encompasses androgen depletion-independent sublines exhibiting increased tumorigenicity and invasiveness. All demonstrated downregulation in the tumor suppressor, E-cadherin, and the metastasis suppressor, KAI-1. PMID: 18247402
Database Links

KEGG: mmu:12521

STRING: 10090.ENSMUSP00000028644

UniGene: Mm.4261

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest expression in the spleen and the kidney. Low expression in skeletal muscle and in the heart.

Q&A

What is mouse CD82 antigen and what are its fundamental characteristics?

Mouse CD82 (also known as KAI1) is a tetraspanin family member that functions as a widely expressed cell surface molecule involved in organizing diverse cellular signaling processes. The protein has a molecular mass of approximately 29.6 kilodaltons and shares significant homology with human CD82 . Mouse CD82 is a membrane glycoprotein belonging to the transmembrane 4 superfamily, with key structural features including four transmembrane domains and a large extracellular loop (LEL) .

The protein plays critical roles in multiple cellular processes, particularly as a metastasis suppressor. It associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway, suggesting important immunoregulatory functions . Expression studies indicate that CD82 is widely distributed across multiple tissues, with particularly notable expression in immune cells and the spleen .

How do recombinant mouse CD82 antigens differ from native mouse CD82?

Recombinant mouse CD82 antigens are laboratory-produced versions of the native protein, typically expressed in heterologous expression systems. The most commonly used recombinant forms include specific domains of CD82 rather than the full-length protein. For example, recombinant mouse CD82 antigen protein (amino acids 111-227) represents a fragment corresponding to portions of the large extracellular loop, which contains important epitopes for antibody recognition .

When working with recombinant CD82, researchers should consider:

  • Expression system effects on post-translational modifications, particularly glycosylation patterns

  • Structural integrity compared to native membrane-embedded protein

  • Functional differences resulting from the absence of transmembrane domains in soluble recombinants

  • Potential conformational changes affecting epitope accessibility

The choice between recombinant fragments versus full-length protein should be guided by specific experimental objectives, as each has distinct advantages for applications like antibody generation, protein interaction studies, or functional assays.

What experimental applications are most suitable for recombinant mouse CD82 antigen?

Recombinant mouse CD82 antigen has proven valuable across multiple experimental applications:

ApplicationSuitabilityKey Considerations
Antibody GenerationExcellentMost commonly used as immunogen for polyclonal and monoclonal antibody production
ELISAHighEffective as coating antigen for detection of CD82-specific antibodies
Protein Interaction StudiesModerateMay need context of membrane environment for certain interactions
Cell Surface DisplayHighCan be incorporated into tANCHOR display systems
Functional AssaysLimitedFull-length protein in proper membrane context often required

When designing experiments with recombinant CD82, researchers should consider whether the specific domain included in the recombinant protein (e.g., 111-227AA) contains the epitopes or functional regions relevant to their research questions . For applications requiring native conformation, membrane-associated expression systems or reconstitution into lipid environments may be necessary.

How can I optimize immunological studies using recombinant mouse CD82 antigen?

Optimizing immunological studies with recombinant mouse CD82 requires careful consideration of several factors:

Antibody Selection and Validation:
When selecting antibodies against CD82, consider both the specific epitope targeted and the antibody format. Many commercial antibodies target different regions of CD82, with some recognizing extracellular/luminal epitopes while others target intracellular domains . For recombinant CD82 containing only portions of the protein (e.g., 111-227AA), verify that your antibody's epitope is present within this region .

Cross-Reactivity Assessment:
Due to sequence homology between mouse and human CD82, confirm species specificity through careful validation. Pre-adsorption techniques, as demonstrated in tANCHOR display studies, can significantly reduce background signals in immunoassays .

Methodological Approach:
For complex immunological studies, consider these optimization steps:

  • Pre-block with unrelated proteins to reduce non-specific binding

  • Include appropriate negative controls (e.g., isotype controls for monoclonal antibodies)

  • Validate antibody specificity using Cd82-knockout tissues/cells

  • Use multi-parameter approaches (combining flow cytometry with imaging) to comprehensively assess CD82 expression and localization

What strategies effectively address challenges in Cd82 knockout model development?

Developing and utilizing Cd82 knockout models presents several challenges that require methodological solutions:

The generation of Cd82-deficient mice has been accomplished through targeted deletion of exon 2, which contains the translation initiation codon. This approach has successfully produced complete knockout models, as confirmed by RT-PCR and protein expression analysis in tissues with normally high CD82 expression (e.g., spleen) .

Key Methodological Considerations:

  • Targeting Strategy: Focus on exon 2 deletion to ensure complete protein ablation, as demonstrated in successful knockout models

  • Background Strain Effects: Backcross to achieve genetic homogeneity (>99% C57BL/6 background was achieved using speed congenics approaches)

  • Validation Approaches:

    • Confirm gene deletion by Southern blotting

    • Verify absence of mRNA by RT-PCR in tissues with known high expression

    • Confirm protein absence by Western blotting or flow cytometry

    • Sequence the recombined locus to confirm the integration and genetic modification

Phenotypic Analysis Challenges:
Interestingly, Cd82-deficient mice show normal viability despite the proposed importance of CD82 in various cellular processes . This unexpected finding underscores the importance of:

  • Longitudinal studies (12-18 months) to detect late-onset phenotypes

  • Comprehensive histopathologic analyses across multiple tissues

  • Blood chemistry and CBC analyses to detect subtle physiological changes

  • Challenging knockout mice with additional stressors to reveal conditional phenotypes

This apparent phenotypic normality suggests potential compensatory mechanisms that warrant investigation through transcriptomic or proteomic approaches.

How can tANCHOR display technology utilizing CD82 advance antigen presentation studies?

The tANCHOR display technology represents an innovative approach to cell surface antigen presentation using CD82 as a scaffold. This method offers significant advantages for immunological studies:

Methodological Principles:
The technique involves replacing the large extracellular loop (LEL) of CD82 with a protein sequence of interest, allowing virtually any peptide or protein domain to be displayed on the cell surface . The tetraspanin CD82 serves as an ideal anchor for this purpose due to its stable membrane integration and exposed loop structure.

Implementation Protocol:

  • Design a construct where your protein/peptide of interest replaces the LEL of CD82

  • Transfect expression cells (commonly HEK293T or HeLa) with the construct

  • Confirm surface expression through flow cytometry or immunofluorescence

  • Use these cells for whole-cell immunization or binding studies

Research Applications:

  • Generation of antibodies against difficult-to-express proteins or peptides

  • Analysis of protein-protein interactions in a membrane context

  • Investigation of receptor-ligand binding dynamics

  • Development of cell-based vaccines

Advantages over Traditional Methods:
The tANCHOR approach offers several benefits compared to conventional recombinant protein immunization:

  • Proteins are displayed in a membrane context, maintaining native conformations

  • Multiple copies of the antigen are presented on each cell, enhancing immunogenicity

  • No need for protein purification, avoiding potential denaturation

  • Adjuvant effects from cellular components can enhance immune responses

What methods best evaluate CD82's role in metastasis suppression?

CD82/KAI1 is recognized as a metastasis suppressor gene, with its downregulation associated with tumor progression in human cancers . Effectively studying this function requires multiple complementary approaches:

Expression Analysis in Tumor Progression:

  • Tissue Microarray Analysis: Evaluate CD82 expression across tumor stages and correlate with clinical outcomes

  • Multi-parameter Immunophenotyping: Combine CD82 with other markers (e.g., p53) to assess correlation patterns

  • Quantitative Methods: Use digital pathology and image analysis for objective quantification of expression levels

Functional Mechanistic Studies:
The metastasis suppressor function of CD82 can be investigated through:

  • Migration/Invasion Assays: Compare wild-type and CD82-knockout or CD82-overexpressing cells in transwell or spheroid invasion models

  • Adhesion Dynamics: Analyze cell-matrix and cell-cell adhesion properties

  • Signaling Studies: Investigate the relationship between CD82 and p53, as their expression is strongly correlated, and loss of both is associated with poor survival in prostate cancer patients

In Vivo Metastasis Models:

  • Orthotopic tumor implantation with CD82-manipulated cells

  • Spontaneous metastasis monitoring in CD82-knockout mice challenged with carcinogenic agents

  • Circulating tumor cell analysis in models with altered CD82 expression

These approaches should be integrated to comprehensively understand CD82's role in metastasis suppression, particularly focusing on the unexpected observation that Cd82-deficient mice display normal viability , which contrasts with its proposed critical role in cancer progression.

What are the optimal conditions for working with recombinant mouse CD82 antigen?

Working with recombinant mouse CD82 requires attention to several technical parameters for optimal results:

Storage and Stability:
Recombinant CD82 preparations should typically be stored at -20°C or -80°C to maintain stability. Repeated freeze-thaw cycles should be avoided . Most preparations contain stabilizers such as glycerol (often 50%) and may include preservatives like Proclin 300 (0.03%) .

Buffer Considerations:
The choice of buffer can significantly impact protein functionality:

  • Phosphate-buffered saline (PBS) at physiological pH (7.4) is commonly used

  • For certain applications, addition of mild detergents may help maintain protein solubility

  • Consider the impact of buffer components on downstream applications

Quality Control Parameters:
When assessing recombinant CD82 quality, evaluate:

  • Purity (typically by SDS-PAGE)

  • Identity confirmation (western blot or mass spectrometry)

  • Endotoxin levels (particularly important for immunization applications)

  • Functional activity (binding to known partners)

How should researchers approach antibody selection for mouse CD82 detection?

Selecting appropriate antibodies for mouse CD82 detection requires careful consideration of several factors:

Antibody Format Considerations:
Multiple formats are available, each with distinct advantages:

FormatApplicationsConsiderations
UnconjugatedWB, IHC, IPRequires secondary detection reagent
Biotin-conjugatedELISA, IHCProvides amplification through avidin-biotin systems
Fluorophore-conjugatedFCM, IFDirect detection without secondary antibodies
HRP-conjugatedWB, ELISADirect enzymatic detection

Epitope Targeting:
Antibodies recognizing different epitopes of CD82 have distinct utilities:

  • Extracellular/luminal epitope antibodies are ideal for flow cytometry and live cell applications

  • Antibodies against intracellular domains may provide higher specificity for fixed samples

  • C-terminal antibodies can distinguish between splice variants

Validation Requirements:
Thorough validation should include:

  • Testing on positive and negative control samples

  • Verification using Cd82-knockout tissues/cells

  • Cross-reactivity assessment with human CD82 and related tetraspanins

  • Application-specific optimization (fixation conditions, antigen retrieval methods)

What are the key challenges in interpreting CD82 expression data across tissue types?

Interpreting CD82 expression data presents several challenges that require methodological solutions:

Tissue-Specific Expression Patterns:
CD82 shows variable expression across tissues, with particularly high levels in lymphoid organs like the spleen . When comparing expression levels:

  • Always include tissue-matched controls

  • Consider using tissue-specific reference genes for normalization in qPCR studies

  • Account for cellular heterogeneity within complex tissues

Technical Variability Sources:
Several factors can impact CD82 detection:

  • Antibody Selection: Different antibodies may recognize distinct epitopes or isoforms

  • Fixation Effects: Membrane proteins like CD82 are sensitive to fixation conditions

  • Extraction Methods: Membrane protein isolation requires specialized approaches

  • Glycosylation Variability: Post-translational modifications may affect antibody recognition

Data Integration Approaches:
To overcome these challenges:

  • Use multiple detection methods (protein and mRNA analysis)

  • Implement standardized scoring systems for immunohistochemistry

  • Consider single-cell approaches to address cellular heterogeneity

  • Validate findings in knockout models to confirm specificity

How might CD82 research inform novel therapeutic approaches?

The metastasis suppressor function of CD82/KAI1 presents intriguing therapeutic opportunities:

Given that CD82 expression is downregulated during tumor progression and can be activated by p53 , several potential therapeutic strategies emerge:

  • Targeted CD82 Re-expression: Developing approaches to restore CD82 expression in tumors might suppress metastatic potential

  • p53-CD82 Axis Modulation: The correlation between p53 and CD82 expression suggests that targeting this regulatory pathway could enhance metastasis suppression

  • CD82-Based Cell Surface Engineering: The tANCHOR display technology using CD82 could be adapted for cellular immunotherapy approaches

Future research should address the apparent contradiction between CD82's proposed critical role in cancer progression and the normal viability of Cd82-knockout mice . Understanding this discrepancy may reveal important compensatory mechanisms or context-dependent functions that could inform more nuanced therapeutic strategies.

What emerging technologies will advance CD82 functional studies?

Several cutting-edge technologies hold promise for deeper understanding of CD82 biology:

Single-Cell Multi-omics:
Integrating single-cell transcriptomics, proteomics, and functional assays will help resolve cell-specific roles of CD82 and identify key interaction partners in different cellular contexts.

Advanced Imaging Approaches:
Super-resolution microscopy and proximity labeling techniques (BioID, APEX) can reveal CD82 nanoscale organization within the membrane and identify transient interaction partners.

Engineered Mouse Models:
Beyond conventional knockouts , conditional and inducible Cd82 models will help dissect tissue-specific and temporal requirements for CD82 function, particularly under stress conditions that may reveal phenotypes not apparent in global knockout models.

Membrane Protein Structure Determination:
Advances in cryo-EM and computational modeling may finally reveal the three-dimensional structure of CD82, providing crucial insights into its function and interaction mechanisms.

These technological advances should be applied to address fundamental questions about CD82 biology, including its precise mechanism of metastasis suppression and the apparent redundancy in normal physiological contexts suggested by viable knockout models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.