Recombinant Mouse CD9 antigen (Cd9)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Regulation

CD9 modulates immune responses through interactions with receptors and signaling pathways:

  • Macrophage Activation: Cross-linking CD9 with Fcγ receptors (FcγRIIB/III) induces protein tyrosine phosphorylation, filopodium formation, and cell aggregation. This co-cross-linking reduces TNF-α production compared to FcγR activation alone, suggesting a regulatory role in inflammation .

  • Dendritic Cell Function: CD9 associates with MHC-II and CD38 in lipid rafts, enabling antigen presentation. CD9 knockout reduces T-cell activation due to impaired MHC-II trafficking and surface expression .

  • Exosome Biogenesis: CD9 is a key marker for exosomes (dexosomes) released by dendritic cells. These vesicles amplify immune responses by delivering MHC-I/II and costimulatory molecules to T-cells and NK cells .

Immune Cell Studies

ApplicationKey FindingsSource
Macrophage SignalingCD9-FcγR co-cross-linking suppresses pro-inflammatory cytokine release
Dendritic Cell ExosomesCD9+ dexosomes enhance T-cell activation and NK cell responses
Platelet ActivationCD9 cross-linking induces platelet degranulation via integrin interactions

Disease Models

DiseaseRole of CD9Source
Glomerulonephritis (CGN)Cd9 knockout in parietal epithelial cells (PECs) prevents glomerular damage
Focal Segmental Glomerulosclerosis (FSGS)CD9 drives PEC migration and β1 integrin expression, contributing to fibrosis
Viral InfectionsCD9 overexpression enhances lentiviral transduction efficiency (e.g., HEK293, B/T lymphocytes)

Kidney Diseases

In mouse models of CGN and FSGS, Cd9 deficiency in PECs reduces crescent formation and proteinuria. CD9 deletion blocks PEC migration and HB-EGF/EGFR signaling, highlighting its role as a therapeutic target for glomerular injury .

Gene Therapy

CD9 overexpression increases the efficiency of lentiviral vector delivery by enhancing vesicle secretion and viral entry. This property could improve gene therapy protocols without requiring viral glycoproteins .

Comparative Analysis of Recombinant CD9 Preparations

ParameterBiomatik (RPC27434) Cusabio (CSB-CF004969MO) R&D Systems (CD9-LEL Fc)
Host SystemE. coliE. coliMammalian (Fc chimera)
Tag10xHis10xHisFc (human IgG1)
Purity>85%>85%Not specified
Primary UseStructural studiesFlow cytometry/Western blotReceptor binding assays

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based solution containing 6% Trehalose.
Description

Our Recombinant Mouse CD9 antigen is a high-quality, reliable reagent designed for researchers in the field of immunology. CD9, a crucial cell surface glycoprotein, plays a pivotal role in various immunological processes. This product is manufactured using a state-of-the-art in vitro E.coli expression system, ensuring precise and consistent production of the protein.

The Recombinant Mouse CD9 antigen encompasses the full length of the protein, spanning amino acids 1 to 226. It is equipped with an N-terminal 10xHis tag, facilitating straightforward detection and purification for your experimental needs. Purity exceeding 85% as determined by SDS-PAGE analysis guarantees high quality and reliability, ensuring accurate and reproducible results in your research.

Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Cd9; CD9 antigen; CD antigen CD9
Datasheet & Coa
Please contact us to get it.
Expression Region
1-226aa
Mol. Weight
28.1 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Immunology
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Cd9
Target Protein Sequence
MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
CD9 is an integral membrane protein associated with integrins. It plays a regulatory role in diverse processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Found on the cell surface of oocytes, CD9 plays a critical role in sperm-egg fusion, potentially by organizing multiprotein complexes and shaping the membrane structure required for fusion. In myoblasts, it interacts with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. In macrophages, CD9 associates with CD9 and beta-1 and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Additionally, it prevents the fusion of mononuclear cell progenitors into osteoclasts, which are responsible for bone resorption. CD9 acts as a receptor for PSG17. It is involved in platelet activation and aggregation and regulates paranodal junction formation. CD9 plays a role in cell adhesion, cell motility, and tumor metastasis. Furthermore, it regulates integrin-dependent migration of macrophages, particularly relevant for inflammatory responses in the lung.
Gene References Into Functions
  1. The Cd9(-/-) and Cd9(-/-) Cd81(-/-) deletions are linked to reduced microvilli density on the MII oocyte surface. Microvilli thickness is notably increased regardless of the deleted tetraspanin gene. Only Cd9 deletion demonstrably disrupts vesicular traffic, increasing the number of clathrin and exosome vesicles. PMID: 27879451
  2. CD9 regulates the T cell-stimulatory capacity of granulocyte-macrophage colony-stimulating factor (GM-CSF)-dependent bone marrow-derived Dendritic Cells (BMDCs), without affecting antigen presentation by fms-like tyrosine kinase 3 ligand (Flt3L)-dependent BMDCs. PMID: 28533221
  3. DPP4:CD9:TTSP protein complexes are essential for efficient early MERS-coronavirus entry. PMID: 28759649
  4. Findings suggest that the suppression of cartilage degradation in CD9(-/-) could be partly attributed to increased expression of aggrecan and type II collagen, the two main cartilage extracellular matrix proteins. PMID: 27784871
  5. Upregulation of CD9 may play a significant role in podocyte morphology, adhesion, and migration. PMID: 25503725
  6. Tetraspanin CD9 and ectonucleotidase CD73 identify an osteochondroprogenitor population with enhanced osteogenic properties. PMID: 25564652
  7. Data indicate that the anti-inflammatory effects of statins are CD9-dependent. PMID: 24040034
  8. A study demonstrates that ablation of Cd9 had no observable effect on the onset of de novo primary prostate tumors, but significantly increased metastasis to the liver, not the lungs. PMID: 23575960
  9. Chemotaxis toward antigen in mast cells is controlled by a cross-talk between FcepsilonRI, tetraspanin CD9, transmembrane adaptor proteins NTAL and LAT, and cytoskeleton-regulatory proteins of the ERM family. PMID: 23443658
  10. Tetraspanin CD9 modulates the molecular organization of integrins in lymphatic endothelial cells, supporting various functions essential for lymphangiogenesis. PMID: 23223239
  11. Tetraspanin family member CD9 plays a crucial role in sperm-egg fusion. PMID: 22609062
  12. Results reveal that SSCs are most concentrated in the CD9(+)EPCAM(low/-) population, suggesting that EPCAM plays a significant role in progenitor cell amplification within the mouse spermatogenic system. PMID: 21858196
  13. The study demonstrated the importance of CD9 in wound re-epithelialization, directly linking it to basement membrane formation and epidermal migration by participating in the regulation of the JNK/MMP-9 pathway. PMID: 21881583
  14. Research proposes that sperm-egg fusion is a direct consequence of CD9-controlled sperm-egg adhesion properties. CD9 generates adhesion sites responsible for the strongest observed gamete interaction. PMID: 21690351
  15. Knockout mice exhibit abnormal adult angiogenesis. PMID: 20592186
  16. This study characterizes CD9 in sperm development and fertilization. PMID: 20428892
  17. Data show that B16F1 clones stably overexpressing CD9 had reduced ability to form colonies in soft agar. PMID: 19777564
  18. CD9 is identified as the first receptor for a murine PSG /glycoprotein 17/. PMID: 11805154
  19. CD9 plays a role in strengthening fertilin beta-mediated cell adhesion. PMID: 11906941
  20. CD9 may be involved in LIF-mediated maintenance of undifferentiated ES cells. PMID: 11950938
  21. CD9 down-regulation could be a sensitive indicator of macrophage differentiation. PMID: 12056820
  22. CD9 inhibits SMC migration by stimulating both stress fiber formation and integrin clustering, leading to increased FAK phosphorylation. PMID: 12083484
  23. The function of CD9 in sperm-egg fusion was analyzed in CD9-deficient mouse eggs. PMID: 12086470
  24. CD9 is enriched in myelinating oligodendrocytes and myelin internodes. Immunoprecipitation of CD9 from postnatal rat cerebrum coprecipitated beta1 integrin, CD81, and Tspan-2. PMID: 12420314
  25. CD9 is found with the alpha6beta1 integrin heterodimer in parietal endoderm cells, suggesting a role for CD9 in alpha6beta1 mediated migration of parietal endoderm. PMID: 12745436
  26. CD9 is localized to paranodes and has a role in regulating paranodal junctional formation. PMID: 14715942
  27. CD9 is dispensable for B cell development and humoral immunity. PMID: 16116178
  28. During oogenesis, the development of the oolemma's ability to fuse with sperm may be regulated by the oocyte's synthesis of CD9. PMID: 16719947
  29. Taken together, these results suggest that CD9 expressed on osteoclast lineage cells might positively regulate osteoclastogenesis via the regulation of p44/42 MAPK activity. PMID: 16808899
  30. CD9 expression by multiple myeloma cells is upregulated in vivo by close interaction of the cells with endothelial cells, and CD9 is involved in transendothelial invasion. PMID: 16900214
  31. CD9 was differentially expressed in the uterus depending on the stage of implantation and was upregulated in an ovarian steroid hormone-dependent manner, implicating multiple roles of CD9 in regulating embryo implantation during the peri-implantation period. PMID: 17126340
  32. Oocyte CD9 is enriched on the microvillar membrane and required for normal microvillar shape and distribution. PMID: 17239847
  33. The expression levels of both CD9 mRNA and protein in frozen oocytes were significantly lower than those found in fresh oocytes. PMID: 17307168
  34. This research establishes, for the first time, a role for CD9 in the tumorigenic process. PMID: 17582603
  35. The fusion-facilitating activity of CD9-containing vesicles is investigated by examining the fusion of sperm to CD9(-/-) eggs with the aid of exogenous CD9-containing vesicles. PMID: 18728192
  36. Immunoglobulin superfamily member IgSF8 (EWI-2) and CD9 in fertilization: evidence of distinct functions for CD9 and a CD9-associated protein in mammalian sperm-egg interaction. PMID: 19210920
  37. Macrophage CD9 negatively regulates LPS response at lipid-enriched membrane microdomains. PMID: 19414803

Show More

Hide All

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.
Tissue Specificity
Expressed predominantly in the peripheral nervous system. Highly expressed in oocytes and blastocysts (at protein level). Expression is also observed on follicular oocytes in the ovary, whereas no expression is found on follicular cells (at protein level)

Q&A

What is CD9 antigen and what are its key structural characteristics?

CD9 is a tetraspanin protein characterized as a type IV transmembrane glycoprotein with four transmembrane domains. It functions primarily in cell-cell adhesion and may play a significant role in signal transduction through interactions with low molecular weight GTP binding proteins . Structurally, CD9 belongs to the tetraspanin family of proteins that are plasma membrane proteins with multiple proposed functions, including activation and sorting of other membrane proteins . The protein's structure facilitates its involvement in targeting proteins to multivesicular bodies (MVBs) and exosomes, making it a valuable marker in exosome research.

Which cell populations express CD9 antigen in mice?

CD9 expression demonstrates a distinct pattern across murine immune cell populations. It is constitutively expressed on:

  • Early B cells

  • Eosinophils

  • Basophils

  • Activated T cells

  • Marginal zone (MZ) B cells

  • B1 cells

  • Plasma cells

  • Platelets (as a major surface component)

Notably, CD9 is expressed on most non-T acute lymphoblastic leukemia cells and on some acute myeloid and chronic lymphoid leukemia cells . CD9 serves as a unique marker for marginal zone B cells, which constitutively express CD9 at both the protein and mRNA level, while follicular (FO) B cells are CD9-negative in their resting state .

How does CD9 expression change during B cell differentiation and activation?

While marginal zone B cells constitutively express CD9, follicular B cells only express CD9 after activation and during differentiation to plasma cells. RT-PCR analysis confirms that MZ B cells, but not FO B cells, express CD9 mRNA transcripts in freshly isolated cells . When follicular B cells are stimulated with lipopolysaccharide (LPS), they begin to express CD9 in the late stages of differentiation toward plasma cells . This expression pattern makes CD9 a valuable marker for tracking B cell differentiation pathways.

The expression timeline shows:

  • Day 1: No CD9 induction in FO B cells

  • Day 3: A minor population of FO B cells begins to express surface CD9

  • Day 5: Approximately 20% of cells express CD9 in high-density cultures, while up to 60% express CD9 in low-density cultures

CD9 appears to be expressed before syndecan-1 (Synd1), another plasma cell marker, depending on culture conditions, and then remains at consistent levels in Synd1+ cells .

What are the validated detection methods for mouse CD9 in research applications?

Based on available literature, several validated methods exist for detecting CD9 in murine samples:

Flow Cytometry: CD9 (clone 2310.9) recombinant mouse monoclonal antibody has been validated for flow cytometric analysis of CD9 expression on cell surfaces . This approach allows researchers to quantify CD9 expression on specific cell populations when combined with other cell surface markers.

Immunofluorescence Microscopy: Anti-CD9 antibodies have been validated for immunofluorescence applications, enabling visualization of CD9 localization in tissue sections or cultured cells .

Western Blot: For protein-level detection and quantification, western blot analysis using validated anti-CD9 antibodies provides information about expression levels across different cell types or experimental conditions .

RT-PCR: For mRNA-level detection, RT-PCR has been successfully employed to detect CD9 transcripts in sorted cell populations, as demonstrated in studies comparing MZ and FO B cells .

When selecting a primary antibody, researchers should consider using recombinant monoclonal antibodies like clone 2310.9, which provides consistent specificity and reproducibility .

How should researchers design experiments to study CD9 induction in B cell subsets?

When designing experiments to study CD9 induction in B cell subsets, researchers should consider the following methodological approach:

  • Cell Isolation and Sorting:

    • Use FACS sorting to isolate pure populations of marginal zone B cells and follicular B cells

    • Verify purity using established markers (e.g., CD21, CD23) before proceeding with CD9 studies

  • Culture Conditions:

    • Cell density significantly impacts CD9 expression kinetics, with low-density cultures (1×10⁴/ml) showing better induction (approximately 60% CD9+ cells) compared to high-density cultures (approximately 20% CD9+ cells at day 5)

    • Include appropriate stimulants:

      • LPS for plasma cell differentiation (CD9 appears after 3 days)

      • LPS plus IL-4 for generating isotype-switched IgG1+Synd1+ cells that also express CD9

  • Time Course Analysis:

    • Monitor CD9 expression at multiple time points (day 1, 3, 5, and 7)

    • Correlate CD9 protein expression with mRNA levels at each time point

  • Co-expression Analysis:

    • Analyze CD9 expression in conjunction with other markers (Synd1, CD43, Ly6C) to track differentiation stages

  • Controls:

    • Include known CD9+ cells (MZ B cells) as positive controls

    • Use CD9-deficient cells or isotype controls for negative control staining

What controls should be implemented when using anti-CD9 antibodies in experimental procedures?

When using anti-CD9 antibodies in experimental procedures, the following controls should be implemented to ensure validity and reproducibility:

Isotype Control: For the CD9 recombinant mouse monoclonal antibody (clone 2310.9), an appropriate isotype control is the Monoclonal Mouse IgG1 Kappa (IGG1/1331) . This control helps distinguish specific from non-specific binding and should match the primary antibody's isotype, species, and concentration.

Positive Controls: Include known CD9-expressing cells such as:

  • Marginal zone B cells

  • Plasma cells

  • Platelets
    These serve as benchmarks for positive staining patterns.

Negative Controls: Include:

  • Freshly isolated follicular B cells (CD9-negative)

  • Germinal center B cells (CD9-negative)

  • Omission of primary antibody

Experimental Validation Controls:

  • Verify specificity using CD9-deficient mice when available

  • Demonstrate concordance between protein detection and mRNA expression

Titration Controls:

  • Perform antibody titration to determine optimal concentration for specific detection

  • Document signal-to-noise ratio at different antibody concentrations

Implementing these controls ensures reliable and reproducible results when working with anti-CD9 antibodies across various experimental platforms.

How can researchers distinguish between constitutive and induced CD9 expression in B cell populations?

Distinguishing between constitutive and induced CD9 expression requires a multifaceted approach:

Temporal Analysis Protocol:

  • Perform baseline flow cytometry on freshly isolated B cell subsets before any stimulation

  • Conduct parallel RT-PCR analysis of CD9 mRNA expression in the same populations

  • Track CD9 expression at defined intervals (6h, 24h, 72h, 120h) after stimulation

  • Compare expression kinetics between naturally CD9+ populations (MZ B cells) and inducible populations (FO B cells)

Marginal zone B cells show constitutive CD9 expression at both protein and mRNA levels in freshly isolated cells, while follicular B cells are CD9-negative initially but can be induced to express CD9 after prolonged LPS stimulation . The appearance of CD9+ cells correlates with the detection of CD9 mRNA in the cultures, indicating de novo synthesis rather than acquisition from other sources .

Identification Markers:

  • Constitutive expression: Present in freshly isolated cells without stimulation

  • Induced expression: Appears only after specific stimulation and increases over time

  • Acquired expression: Rapid appearance without corresponding mRNA increase

A comparative analysis of CD9 expression in different mouse strains (BALB/c and C57BL/6) confirms that the pattern of constitutive CD9 mRNA expression in MZ B cells is consistent across genetic backgrounds .

What methodological approaches can resolve contradictory findings in CD9 expression studies?

When researchers encounter contradictory findings in CD9 expression studies, the following methodological approaches can help resolve discrepancies:

Multi-level Analysis Protocol:

  • Compare protein expression using multiple detection methods (flow cytometry, western blot, immunofluorescence)

  • Correlate protein detection with mRNA expression using RT-PCR or RNA-seq

  • Examine post-transcriptional regulation mechanisms that might explain protein-mRNA discrepancies

  • Investigate culture condition effects on expression patterns

Research has shown that culture density significantly impacts CD9 induction, with low-density cultures (1×10⁴/ml) showing approximately 60% CD9+ cells by day 5, compared to only 20% in high-density cultures . This finding illustrates how methodological variables can produce seemingly contradictory results.

Standardization Approaches:

  • Use consistent antibody clones across studies (e.g., clone 2310.9 for mouse CD9)

  • Standardize flow cytometry gating strategies and presentation

  • Report detailed experimental conditions, including cell densities and culture media composition

  • Include positive and negative controls in each experiment

Genetic Confirmation:

  • Use CD9-deficient mice as negative controls

  • Perform gene knockdown/knockout studies to confirm antibody specificity

  • Consider strain-specific differences in expression patterns

How do CD9 expression patterns in mice translate to human systems in translational research?

Translating findings from mouse CD9 studies to human systems requires careful consideration of similarities and differences:

Expression Pattern Comparison:
CD9 expression shows both similarities and differences between mouse and human immune cells:

  • In both species, CD9 is expressed on early B cells, eosinophils, basophils, and platelets

  • Human tonsil plasma cells express CD9, similar to murine plasma cells

  • Both species use CD9 as an exosome marker protein

Methodological Approach for Cross-Species Translation:

  • Perform parallel analyses of mouse and human samples using species-specific antibodies

  • Compare expression patterns across equivalent cell populations defined by conserved markers

  • Validate functional significance through comparable functional assays

  • Use humanized mouse models when appropriate for verification

Verification Techniques:

  • Confirm antibody specificity for the appropriate species-specific CD9 variant

  • Utilize recombinant protein standards from both species for quantitative comparisons

  • Perform side-by-side flow cytometry analysis of equivalent human and mouse cell populations

While mouse models provide valuable insights, researchers should recognize that expression patterns and functional significance may vary between species, necessitating direct validation in human systems for translational applications.

How should researchers analyze CD9 expression data in the context of B cell development?

When analyzing CD9 expression data in B cell development contexts, researchers should implement the following analytical framework:

Developmental Timeline Analysis:

  • Establish a comprehensive B cell developmental map with defined stages

  • Plot CD9 expression levels (MFI or percent positive) against developmental markers

  • Identify transition points where CD9 expression changes significantly

  • Correlate with functional capabilities at each stage

Based on available data, CD9 expression marks distinct populations within the B cell lineage:

  • Constitutively expressed on marginal zone B cells

  • Absent on follicular B cells

  • Absent on germinal center B cells

  • Present on plasma cells (both IgM+ and isotype-switched)

Comparative Expression Table:

B Cell SubsetCD9 ProteinCD9 mRNAInduction by LPSCo-markers
Marginal Zone BPositivePositiveUpregulatedCD21hi, CD23lo
Follicular BNegativeNegativeInduced after day 3CD21lo, CD23hi
Germinal Center BNegativeNot reportedNot applicableGL7+, PNA+
IgM+ Plasma CellsPositivePositiveMaintainedSynd1+, CD43+
IgG1/IgA Plasma CellsPositiveNot reportedInducedSynd1+, CD43+

Quantitative Analysis Approaches:

  • Measure mean fluorescence intensity (MFI) rather than just percent positive cells

  • Track temporal changes in expression levels during differentiation

  • Perform cluster analysis to identify populations with similar marker expression patterns

  • Use dimensionality reduction techniques (e.g., tSNE, UMAP) for visualization

What experimental controls are critical for validating CD9 function in knockout or knockdown studies?

When conducting CD9 knockout or knockdown studies, the following experimental controls are critical for valid interpretation:

Genetic Manipulation Controls:

  • Validation of Knockout/Knockdown Efficiency:

    • Verify CD9 deletion at DNA level using PCR

    • Confirm absence of CD9 mRNA using RT-PCR or RNA-seq

    • Demonstrate protein absence using western blot and flow cytometry

    • Quantify knockdown efficiency when using siRNA or shRNA approaches

  • Off-Target Effect Controls:

    • Use scrambled siRNA sequences for RNAi studies

    • Include wild-type littermates for genetic knockout models

    • Rescue experiments restoring CD9 expression to confirm phenotype specificity

Functional Validation Controls:

  • Positive Controls:

    • Include known CD9-dependent processes (e.g., cell adhesion assays)

    • Use cell types with established CD9 functions (e.g., platelets, exosomes)

  • Negative Controls:

    • Test CD9-independent functions to demonstrate specificity

    • Include CD19-deficient mice as a comparative model since CD19 affects B cell development

  • Strain-Specific Controls:

    • Use multiple genetic backgrounds to account for strain-specific effects

    • Include CBA/CaN (xid) mice that show altered plasma cell CD9 expression

Phenotypic Analysis Guidelines:

  • Analyze multiple B cell subsets including marginal zone, follicular, and plasma cells

  • Examine both constitutive and inducible CD9 expression

  • Assess both developmental and functional consequences of CD9 absence

  • Compare in vitro and in vivo phenotypes to validate physiological relevance

How do changes in CD9 expression correlate with functional changes in B cells?

The correlation between CD9 expression and B cell functional changes provides important insights into the protein's biological significance:

Functional Correlation Analysis:

  • CD9 expression on marginal zone B cells correlates with their specialized functions:

    • Enhanced responses to T-independent antigens

    • Rapid antibody production capabilities

    • Distinct adhesion properties

  • CD9 induction during plasma cell differentiation coincides with:

    • Increased antibody secretion capacity

    • Altered migratory behavior

    • Changed adhesion properties

  • CD9 expression on plasma cells correlates with their maturation state:

    • Present on both early IgM+ and later isotype-switched plasma cells

    • Maintained on long-lived plasma cells

    • Expressed alongside other plasma cell markers (Synd1, CD43, Ly6C)

Experimental Approaches to Assess Functional Correlation:

  • Cell Sorting Based on CD9 Expression:

    • Compare functional capabilities of CD9+ vs. CD9- populations within the same lineage

    • Assess antibody secretion, proliferation, and survival

  • Temporal Correlation:

    • Track CD9 expression alongside functional changes during differentiation

    • Determine whether CD9 expression precedes or follows functional changes

  • Manipulation Studies:

    • Block CD9 function using antibodies and assess impact on B cell functions

    • Correlate CD9 expression levels with functional readouts using dose-response analysis

Research indicates that CD9 may function in cell-cell adhesion in pre-B cells and potentially participates in signal transduction through interactions with low molecular weight GTP binding proteins . The protein's expression pattern suggests specific roles in marginal zone B cell function and plasma cell differentiation.

What emerging technologies can advance our understanding of CD9 function in immune regulation?

Several cutting-edge technologies hold promise for deepening our understanding of CD9 function in immune regulation:

Single-Cell Technologies:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Map CD9 expression across the entire immune repertoire at single-cell resolution

    • Identify previously unrecognized CD9+ populations

    • Correlate CD9 expression with global transcriptional programs

  • CyTOF (Mass Cytometry):

    • Simultaneously analyze CD9 alongside dozens of other markers

    • Create high-dimensional phenotypic maps of CD9+ cells

    • Track rare subpopulations through development and activation

Advanced Imaging Approaches:

  • Super-Resolution Microscopy:

    • Visualize CD9 distribution within tetraspanin-enriched microdomains

    • Track CD9 dynamics during immune synapse formation

    • Analyze co-localization with signaling partners at nanoscale resolution

  • Intravital Imaging:

    • Monitor CD9+ cell behavior in living tissues

    • Track migration, interaction, and function of CD9+ cells in real-time

    • Assess the impact of CD9 blockade on cellular dynamics

Genetic Manipulation Technologies:

  • CRISPR-Cas9 Gene Editing:

    • Generate precise mutations in CD9 functional domains

    • Create conditional knockout models for temporal control of CD9 expression

    • Introduce reporter tags to track CD9 expression without antibodies

  • AAV-Mediated Gene Transfer:

    • Restore CD9 expression in specific cell types in knockout models

    • Express modified versions of CD9 to assess domain-specific functions

How might CD9's role in exosome biology inform therapeutic approaches?

CD9's established role as an exosome marker opens several avenues for therapeutic development:

Exosome-Based Therapeutic Applications:

  • Engineered Exosomes for Targeted Delivery:

    • CD9 can serve as an anchor point for therapeutic cargo loading

    • CD9-enriched exosomes may have distinct targeting properties

    • Manipulating CD9 levels may alter exosome uptake by recipient cells

  • Exosome-Based Biomarkers:

    • CD9+ exosomes from specific cellular sources may serve as disease biomarkers

    • Ratio of CD9 to other tetraspanins (CD63, CD81) on exosomes may indicate cellular origin

    • Changes in exosomal CD9 levels may reflect alterations in immune cell activation

Methodological Approaches for Exosome Research:

  • Isolation and Characterization:

    • Anti-CD9 antibodies can be used for immunocapture of exosomes

    • CD9 quantification helps standardize exosome preparations

    • Multiple tetraspanin markers (CD9, CD63, CD81) provide comprehensive exosome characterization

  • Functional Analysis:

    • Compare functions of CD9-high versus CD9-low exosome populations

    • Assess the impact of CD9 blockade on exosome uptake and function

    • Investigate CD9's role in protein sorting into multivesicular bodies (MVBs) and exosomes

Tetraspanins like CD9 are thought to play a role in the targeting of proteins to multivesicular bodies and exosomes, making them valuable targets for engineering exosome-based therapeutics . Understanding CD9's contribution to exosome biogenesis and function could lead to novel approaches for treating immune-mediated diseases.

What are the key unresolved questions regarding CD9 in B cell development and function?

Despite significant advances in our understanding of CD9 biology, several important questions remain unresolved:

Developmental Biology Questions:

  • Lineage Determination:

    • Does CD9 expression influence cell fate decisions in B cell development?

    • What transcription factors regulate CD9 expression in different B cell subsets?

    • Why do marginal zone B cells constitutively express CD9 while follicular B cells do not?

  • Functional Significance:

    • Does CD9 directly contribute to the specialized functions of marginal zone B cells?

    • What is the functional significance of CD9 induction during plasma cell differentiation?

    • How does CD9 interact with other tetraspanins in specialized membrane microdomains?

Methodological Approaches to Address These Questions:

  • Lineage Tracing Studies:

    • Track the fate of CD9+ progenitors throughout B cell development

    • Use inducible reporter systems to visualize CD9 expression dynamics

    • Perform adoptive transfer experiments with sorted CD9+ versus CD9- populations

  • Molecular Interaction Analysis:

    • Identify CD9 binding partners in different B cell subsets using proximity labeling

    • Map the interactome of CD9 during different stages of B cell differentiation

    • Investigate the impact of CD9 on membrane organization and signaling complex formation

  • Functional Genomics:

    • Perform transcriptional profiling of sorted B cell populations based on CD9 expression

    • Use ATAC-seq to identify open chromatin regions associated with CD9 expression

    • Implement ChIP-seq to identify transcription factors regulating CD9 expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.