Recombinant Mouse Cell cycle control protein 50A (Tmem30a)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Mouse Cell Cycle Control Protein 50A, also known as Tmem30a, Cdc50a, or P4-ATPase flippase complex beta subunit TMEM30A, is a protein associated with cell cycle control and intracellular trafficking . Studies on Tmem30a have revealed its importance in various cellular functions, including protein folding, transport, and the maintenance of endoplasmic reticulum (ER) homeostasis .

Characteristics

CharacteristicDescription
AliasesTmem30a; Cdc50a; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A
FunctionCell cycle control; intracellular trafficking
ExpressionE. coli (in recombinant form)
TagHis-tagged (N-terminal)
Molecular WeightVaries based on species and modifications
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol (final concentration) for long-term storage at -20℃/-80℃

Function and Significance

Tmem30a plays a crucial role in maintaining cellular homeostasis and proper functioning of various tissues.

  • Cerebellar Function: Research indicates that Tmem30a is essential for the survival and function of Purkinje cells (PCs) in the cerebellum . Deletion of Tmem30a in PCs leads to early-onset ataxia, progressive PC death, and cerebellar atrophy . This is often associated with increased expression of glial fibrillary acidic protein and astrogliosis in regions experiencing PC loss .

  • ER Stress and Apoptosis: Deficiency in Tmem30a can induce endoplasmic reticulum (ER) stress, as evidenced by elevated levels of C/EBP homologous protein and BiP expression in PCs . This ER stress precedes visible cell loss and can result in apoptotic cell death in the cerebellum .

  • Retinal Function: Studies have demonstrated that Tmem30a is vital for retinal health. Loss of Tmem30a in mouse cone cells results in mislocalization of cone opsin, loss of photopic electroretinogram (ERG) responses, and degeneration of cone cells . Broad deficiency of Tmem30a in adult mice leads to reduced scotopic photoresponse and mislocalization of ATP8A2, contributing to retinal dysfunction and cell death .

  • Intracellular Trafficking: Tmem30a is suggested to play a critical role in intracellular trafficking . It affects the activity of PS flippase and the exposure of PS on the cell surface .

Research Findings

Several studies highlight the impact of Tmem30a on different tissues and cellular processes.

  • Neurodegeneration: Tmem30a is essential for ER homeostasis and the survival of cerebellar PCs, with its dysfunction directly linked to neurodegeneration .

  • Retinal Degeneration: Loss of Tmem30a leads to mislocalization of PS flippase ATP8A2 and degeneration of retinal rod and cone cells .

  • CLPP-1071 and Cell Cycle Arrest: While not directly Tmem30a, the compound CLPP-1071, discovered through research, induces cell cycle arrest in a dose-dependent manner and impacts mitochondrial function, showing potential antitumor activity .

Tables of Related Recombinant Proteins

Cat.No.ProductSpecies
TMEM30A-17031MRecombinant Mouse TMEM30A ProteinMouse
RFL8353MFRecombinant Full Length Mouse Cell Cycle Control Protein 50A(Tmem30a) Protein, His-TaggedMouse
RFL10350HFRecombinant Full Length Human Cell Cycle Control Protein 50A(Tmem30a) Protein, His-TaggedHuman
TMEM30A-1821HFLRecombinant Full Length Human TMEM30A protein, Flag-taggedHuman
TMEM30A-5819RRecombinant Rat TMEM30A Protein, His (Fc)-Avi-taggedRat
RFL4678RFRecombinant Full Length Rat Cell Cycle Control Protein 50A(Tmem30a) Protein, His-TaggedRat

Chemical compounds impacting cell cycle

CompoundEC50 (nM)IC50 (nM)
Mixture 5250.61 ± 9.5911.11 ± 0.36
52a23.49 ± 0.144.61 ± 0.21
52b'252.15 ± 1.25>250
52b"739.25 ± 10.45>250

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will accommodate your request.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Tmem30a; Cdc50a; D9Wsu20e; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-364
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AMNYSAKDEVDGGPAGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPNVTSCACTINFTLKQSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKECEPYRRNEDRPIAPCGAIANSMFND TLELYLVANESDPKPIPIPLKKKGIAWWTDKNVKFRNPPGKESLEEKFKDTIKPVNWHKA VYELDPEDESNNGFINEDFIVWMRTAALPTFRKLYRLIERRDDLHPTLPAGQYFLNITYN YPVHSFDGRKRMILSTISWMGGKNPFLGIAYITIGSISFLLGVVLLVINHKYRNSSNTAD ITI
Uniprot No.

Target Background

Function

CDC50A is an accessory component of a P4-ATPase flippase complex. This complex catalyzes ATP hydrolysis, coupled with the transport of aminophospholipids from the outer to the inner leaflet of various membranes. This maintains the asymmetric distribution of phospholipids. Phospholipid translocation is also implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit may aid in phospholipid substrate binding. CDC50A is essential for the proper folding, assembly, and ER-to-Golgi transport of the ATP8A2:TMEM30A flippase complex. The ATP8A2:TMEM30A complex may regulate neurite outgrowth and, when reconstituted into liposomes, primarily transports phosphatidylserine (PS) and, to a lesser extent, phosphatidylethanolamine (PE). The ATP8A1:TMEM30A flippase complex appears to regulate cell migration, possibly through flippase-mediated phosphatidylethanolamine (PE) translocation at the plasma membrane. CDC50A is required for the formation of intermediate phosphoenzymes in the ATP8A2, ATP8B1, and ATP8B2 P-type ATPases. It's involved in platelet-activating factor (PAF) uptake and can also mediate the export of alpha subunits (ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B, and ATP11C) from the ER to other membrane locations.

Gene References Into Functions
  1. TMEM30A may be a novel genetic determinant of intrahepatic cholestasis. PMID: 28919113
  2. CDC50A exists as a fully glycosylated protein in vivo, suggesting interaction with distinct P4 ATPases. PMID: 22253360
Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle membrane. Apical cell membrane.
Tissue Specificity
Expressed in photoreceptor cells; detected in retina outer segment (at protein level). Detected in hepatocytes liver sinusoidal endothelial cells and kidney brush border of the proximal tubules (at protein level). Expressed in brain (at protein level).

Q&A

What is the basic structure of mouse Tmem30a protein?

Mouse Tmem30a (also known as CDC50A) is a transmembrane protein that functions as a β-subunit of P4-ATPase flippase complexes. The protein contains 2 transmembrane domains connected by an extracellular loop featuring 3 conserved cysteine residues and an N-glycosylation site . Mouse Tmem30a is structurally similar to human TMEM30A with a sequence length of approximately 361 amino acids, though species-specific variations exist . The protein exhibits a highly conserved structure across vertebrates, with the chicken homolog having 372 amino acids but maintaining similar domain organization .

When designing experiments to study Tmem30a structure, researchers should consider using epitope tags that do not interfere with the transmembrane regions. His-tagging at the N-terminus has been successfully implemented in recombinant expression systems, yielding functional protein with greater than 90% purity as determined by SDS-PAGE .

What are the primary cellular functions of Tmem30a?

Tmem30a serves as an essential accessory component of P4-ATPase flippase complexes that mediate the ATP-dependent translocation of aminophospholipids from the outer to the inner leaflet of various cellular membranes . This function is critical for maintaining the asymmetric distribution of phospholipids across membrane bilayers, which in turn regulates:

  • Cell membrane structure stability and integrity

  • Vesicle-protein transport within cells

  • Blood clotting processes

  • Recognition of apoptotic cells

  • Establishment and maintenance of cell polarity

Specifically, Tmem30a forms complexes with different P4-ATPase partners, including ATP8A1, ATP8A2, ATP8B1, and ATP8B2. The ATP8A2-TMEM30A complex has been implicated in neurite outgrowth regulation, while the ATP8A1-TMEM30A complex participates in cell migration processes . Additionally, Tmem30a has been found to facilitate the uptake of synthetic drug alkylphospholipid edelfosine and platelet-activating factor (PAF) .

How does the expression pattern of Tmem30a differ from its paralogs?

The mammalian genome encodes three TMEM30 proteins (TMEM30A, TMEM30B, and TMEM30C), which exhibit distinct expression patterns:

TMEM30 ProteinExpression PatternNotable Characteristics
TMEM30AUbiquitous expression across tissues including brain, lung, cerebellum, liver, kidney, spine, testicles, adrenal, appendix, colon, thyroid, urinary bladderMost widely expressed of the paralogs; essential for various P4-ATPase functions
TMEM30BWidely expressed but with tissue-specific variationsImportant paralog of TMEM30A with some functional redundancy
TMEM30CRestricted to testes and brainHighly tissue-specific expression with specialized functions

When conducting expression analyses, researchers should note that Tmem30a appears to be the predominant isoform in most tissues, with alternative splicing generating three distinct isoforms (1, 2, and 3), of which isoform 1 is considered the canonical sequence . This expression pattern makes Tmem30a particularly relevant for studies involving multiple organ systems or when investigating fundamental cellular processes.

What are the optimal conditions for expressing and purifying recombinant mouse Tmem30a?

The expression and purification of recombinant mouse Tmem30a requires careful consideration of several methodological factors:

Purification Protocol:

  • Express the full-length protein with an N-terminal His tag

  • Purify using immobilized metal affinity chromatography

  • Verify purity by SDS-PAGE (target >90% purity)

  • Lyophilize the purified protein for storage stability

Storage and Handling:

  • Store lyophilized protein at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to 5-50% final concentration (50% is recommended)

  • Working aliquots can be stored at 4°C for up to one week

Buffer Conditions:
Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been determined to provide optimal stability for the recombinant protein .

What in vivo and in vitro models are available for studying Tmem30a function?

Researchers have developed several models to investigate Tmem30a function:

In Vivo Models:

  • Purkinje Cell-Specific Knockout: Tmem30a LoxP/LoxP mice crossed with Purkinje cell-specific Cre lines resulted in early-onset ataxia and progressive Purkinje cell death, demonstrating Tmem30a's critical role in cerebellar function .

  • Podocyte-Specific Knockout: Tmem30a LoxP/LoxP; NPHS2-Cre mice exhibited albuminuria, podocyte damage and loss, mesangial cell proliferation, and significant extracellular matrix accumulation, eventually developing focal segmental glomerulosclerosis (FSGS) .

In Vitro Models:

  • Tmem30a Knockdown Cell Lines: siRNA or shRNA-mediated knockdown of Tmem30a in cultured podocytes has been used to study its role in kidney cell function .

  • Neuronal Models: Hippocampal neurons with Tmem30a deficiency showed reduced axon length, indicating its role in neuronal differentiation .

When selecting a model system, researchers should consider their specific research questions. For kidney disease studies, podocyte-specific models offer relevant insights, while neurological investigations benefit from neuronal or Purkinje cell-specific models.

How can researchers effectively analyze the impact of Tmem30a knockout or knockdown on cellular phenotypes?

Analysis of Tmem30a knockout/knockdown effects requires a multi-omics approach:

Transcriptomic Analysis:

  • RNA sequencing of control versus Tmem30a-deficient cells/tissues

  • Gene Set Enrichment Analysis (GSEA) to identify affected pathways

  • Protein-Protein Interaction (PPI) network construction using STRING and visualization with Cytoscape

Metabolomic Analysis:

  • Principal Component Analysis (PCA) and Partial Least Squares Discriminant Analysis (PLS-DA) to identify metabolite profile differences

  • Differential metabolite identification (criteria: P < 0.05, variable importance in projection > 1)

  • Pathway analysis using MetaboAnalyst 5.0

Integrated Analysis:
Conjoint transcriptome and metabolome analysis has revealed that Tmem30a knockdown affects multiple pathways including:

  • Glutathione metabolism

  • Drug metabolism

  • Purine metabolism

  • Glycolysis/gluconeogenesis

  • Aminoacyl-tRNA biosynthesis

  • Glycerophospholipid metabolism

Validation Techniques:

  • Real-time PCR to verify expression changes of key genes

  • Western blotting to quantify protein expression levels

  • Immunofluorescence staining to assess protein localization and expression patterns

This integrated approach has successfully identified glycolysis as a key pathway affected by Tmem30a deficiency, with reduced expression of glycolysis-related genes (ALDOA, HK2, LDHA, and GAPDH) in Tmem30a knockdown podocytes .

What role does Tmem30a play in kidney disease models, particularly FSGS?

Tmem30a has been identified as a critical protein in podocyte health and kidney function:

Podocyte-Specific Knockout Phenotype:
Podocyte-specific Tmem30a knockout mice (Tmem30a LoxP/LoxP; NPHS2-Cre) develop focal segmental glomerulosclerosis (FSGS) characterized by:

  • Albuminuria

  • Podocyte damage and loss

  • Mesangial cell proliferation

  • Significant extracellular matrix accumulation

Molecular Mechanisms:
Integrative transcriptomic and metabolomic analyses revealed that Tmem30a knockdown in podocytes leads to:

  • Reduced Glycolysis: Decreased expression of key glycolytic enzymes:

    • Hexokinase 2 (HK2)

    • Aldolase A (ALDOA)

    • Glyceraldehyde 3-phosphate dehydrogenase (GAPDH)

    • Lactate dehydrogenase A (LDHA)

  • Altered Metabolic Pathways:

    • Disrupted glycine, serine, and threonine metabolism

    • Changes in aminoacyl-tRNA biosynthesis

    • Alterations in phenylalanine, tyrosine, and tryptophan biosynthesis

    • Modified cysteine and methionine metabolism

Translational Relevance:
The expression of glycolysis-related proteins was not only reduced in Tmem30a knockout mice but also in human patients with FSGS, suggesting that Tmem30a-mediated glycolytic regulation may be a conserved mechanism in podocyte health and FSGS pathogenesis .

When studying kidney disease models, researchers should carefully monitor podocyte morphology, proteinuria development, and glycolytic enzyme expression to fully characterize the impact of Tmem30a alterations.

How does Tmem30a function in neurological systems?

Tmem30a plays critical roles in neuronal development and maintenance:

Neuronal Expression and Function:

  • Highly expressed in the brain and cerebellum

  • Forms complexes with ATP8A2, which regulates neurite outgrowth

  • Deficiency in hippocampal neurons reduces axon length, indicating involvement in neuronal differentiation

Purkinje Cell Maintenance:
Purkinje cell-specific Tmem30a knockout mice display:

  • Early-onset ataxia

  • Progressive Purkinje cell death

  • Disrupted cerebellar function

This suggests that Tmem30a is essential for maintaining normal cerebellar function and Purkinje cell morphology. Researchers investigating neurological aspects of Tmem30a should consider both developmental impacts (neurite outgrowth, axon formation) and maintenance functions (Purkinje cell survival), potentially through its role in membrane phospholipid organization.

What are the implications of Tmem30a mutations in human diseases?

Several human disease associations have been identified for TMEM30A:

Intrahepatic Cholestasis:
TMEM30A mutations have been associated with intrahepatic cholestasis, a liver condition characterized by impaired bile flow . This connection likely relates to the role of TMEM30A in maintaining proper membrane phospholipid distribution in hepatocytes.

Potential Role in FSGS:
The finding that podocyte-specific Tmem30a knockout mice develop FSGS suggests that TMEM30A mutations or expression changes might contribute to human FSGS pathogenesis . Studies with human FSGS patients have shown reduced expression of glycolysis-related proteins similar to those observed in Tmem30a-deficient mouse models .

Neurological Disorders:
Given its critical role in neuronal development and Purkinje cell maintenance, TMEM30A may be implicated in neurological disorders featuring cerebellar dysfunction or neuronal development abnormalities, though direct human mutation evidence is still evolving.

Researchers investigating potential disease associations should consider screening for TMEM30A mutations or expression changes in patients with these conditions, particularly focusing on the functional domains identified in structural studies.

How can multi-omics approaches enhance our understanding of Tmem30a function?

Multi-omics integration provides powerful insights into Tmem30a function:

Transcriptomics and Metabolomics Integration:
The combination of transcriptomic and metabolomic analyses of Tmem30a knockout/knockdown models has revealed:

  • Pathway Convergence: Both approaches identified glycolysis/gluconeogenesis as a key affected pathway .

  • Complementary Insights:

    • Transcriptomics revealed changes in gene expression patterns

    • Metabolomics identified altered metabolite levels

    • Combined analysis strengthened pathway identification confidence

Implementation Strategy:

  • Perform RNA-seq and metabolite profiling on the same samples

  • Analyze datasets separately using appropriate bioinformatics tools

  • Integrate findings through pathway analysis

  • Validate key nodes with molecular and biochemical techniques

Key Findings from Integrated Analysis:
Conjoint transcriptome and metabolome analysis of Tmem30a-deficient podocytes identified several enriched pathways:

  • Glutathione metabolism

  • Drug metabolism—cytochrome P450

  • Drug metabolism—other enzymes

  • Purine metabolism

  • Metabolism of xenobiotics by cytochrome P450

  • Glycolysis/gluconeogenesis

  • Aminoacyl-tRNA biosynthesis

  • Glycerophospholipid metabolism

  • Alanine, aspartate and glutamate metabolism

  • Fructose and mannose metabolism

This approach provides a more comprehensive understanding of how Tmem30a deficiency affects cellular metabolism and function than either omics approach alone.

What specialized techniques are recommended for studying the interaction between Tmem30a and P4-ATPases?

Studying Tmem30a-P4-ATPase interactions requires specialized biochemical and biophysical approaches:

Co-Immunoprecipitation (Co-IP):

  • Use antibodies against Tmem30a to pull down associated P4-ATPases

  • Alternatively, use antibodies against specific P4-ATPases (ATP8A1, ATP8A2, ATP8B1, ATP8B2) to capture Tmem30a complexes

  • Analyze precipitated complexes by western blotting or mass spectrometry

Bimolecular Fluorescence Complementation (BiFC):

  • Tag Tmem30a and P4-ATPases with complementary fragments of fluorescent proteins

  • Express constructs in cells and analyze interaction-dependent fluorescence

  • This approach allows visualization of interactions in living cells

Flippase Activity Assays:

  • Express Tmem30a with specific P4-ATPases in cell models

  • Measure phospholipid translocation using fluorescently labeled phospholipid analogs

  • Compare activity with and without Tmem30a to determine its contribution to flippase function

Cryo-Electron Microscopy:
For structural analysis of the Tmem30a-P4-ATPase complex, cryo-EM can provide insights into:

  • Binding interfaces between Tmem30a and its P4-ATPase partners

  • Conformational changes during the phospholipid translocation cycle

  • Structural basis for specificity between different Tmem30-P4-ATPase combinations

These approaches collectively provide a comprehensive understanding of how Tmem30a interacts with and regulates P4-ATPases to maintain phospholipid asymmetry across cellular membranes.

What are the key unresolved questions about Tmem30a that warrant further investigation?

Despite significant advances in understanding Tmem30a function, several important questions remain:

  • Tissue-Specific Functions: How does Tmem30a function differ across tissues, particularly in contexts where it shows high expression (brain, kidney, liver)?

  • Regulatory Mechanisms: What controls the expression and activity of Tmem30a in normal and pathological conditions?

  • P4-ATPase Specificity: What determines the specificity of Tmem30a for different P4-ATPase partners, and how does this influence cellular function?

  • Therapeutic Potential: Could targeting Tmem30a or its downstream pathways (particularly glycolysis) provide therapeutic benefits in conditions like FSGS?

  • Compensatory Mechanisms: To what extent can Tmem30b compensate for Tmem30a deficiency in different tissues, and what determines this redundancy?

Addressing these questions will require continued development of sophisticated model systems, including conditional knockout mice, cell-specific ablation strategies, and advanced imaging techniques to visualize Tmem30a dynamics in live cells.

What technological advances might facilitate better characterization of Tmem30a in the near future?

Emerging technologies hold promise for advancing Tmem30a research:

  • CRISPR-Cas9 Gene Editing: Precise modification of Tmem30a in cell and animal models to study specific domains or post-translational modifications

  • Single-Cell Omics: Analysis of Tmem30a expression and function at single-cell resolution to understand cell-specific roles

  • Spatial Transcriptomics and Proteomics: Mapping Tmem30a expression and interaction partners in tissue contexts with spatial resolution

  • Advanced Microscopy Techniques: Super-resolution microscopy and live-cell imaging to visualize Tmem30a dynamics and trafficking

  • Organ-on-a-Chip Models: Development of microphysiological systems to study Tmem30a function in tissue-specific contexts, particularly for kidney and neurological applications

These technological advances will enable more comprehensive characterization of Tmem30a biology and potentially reveal new therapeutic opportunities for conditions involving Tmem30a dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.