Recombinant Mouse Cell cycle control protein 50B (Tmem30b)

Shipped with Ice Packs
In Stock

Description

Protein Identity

ParameterDescription
Gene NameTmem30b (Mouse)
AliasesCDC50B, Cell cycle control protein 50B, Transmembrane protein 30B
UniProt IDQ8BHG3
Length353 amino acids
Transmembrane Domains2 domains
Key FeaturesN-glycosylation sites, extracellular loop with cysteine residues

The recombinant mouse Tmem30b is produced via cell-free expression or bacterial systems, yielding >85% purity as confirmed by SDS-PAGE .

Primary Biological Activities

Tmem30b functions as a β-subunit for P4-ATPase flippases, enabling:

  1. Phospholipid Translocation: Transport of aminophospholipids (e.g., phosphatidylserine) to the inner membrane leaflet, crucial for lipid asymmetry .

  2. Membrane Protein Trafficking: Export of α-subunits (e.g., ATP8A1, ATP8B1) from the endoplasmic reticulum (ER) to the plasma membrane .

  3. Vesicle Formation: Facilitation of lipid signaling molecule uptake and vesicular transport .

Key Studies and Observations

Study FocusKey FindingsImplications
Odontoblastic DifferentiationDeletion of Tmem30b impaired protein secretion and odontoblast maturation in mouse dental pulp cells (mDPCs). Overexpression partially rescued secretion defects .Highlights Tmem30b’s role in protein transport and extracellular matrix formation.
P4-ATPase Complex AssemblyTmem30b interacts with ATP8A2 in HEK293T cells, forming a heteromeric complex for phosphatidylserine/phosphatidylethanolamine transport .Demonstrates substrate specificity in lipid flipping.
Toxicant ResponseExposure to bisphenol F, titanium dioxide, or sodium dichromate upregulates Tmem30b expression in murine models .Suggests a role in cellular stress responses.

Experimental Tools and Methodologies

Disease Associations

ConditionMechanismEvidence
MeningiomaAltered TMEM30B expression linked to tumor development .Observed in human meningioma and bladder tumor samples.
Pancreatic CancerElevated TMEM30B expression reported in pancreatic carcinoid and tumor tissues .Suggests a role in cancer progression or lipid metabolism dysregulation.

Mouse Tmem30b Expression

TissueExpression LevelFunctional Context
Pancreatic IsletHigh expressionPotential role in insulin secretion or β-cell function.
KidneyModerate expressionLikely involvement in renal lipid metabolism.
ProstateModerate expressionMay regulate phospholipid dynamics in epithelial cells.

Data derived from murine expression databases and toxicant response studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
Tmem30b; Cdc50b; Cell cycle control protein 50B; Transmembrane protein 30B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem30b
Target Protein Sequence
MTWSATARGAHQPDNTAFTQQRLPAWQPLLSAGIALPLFFCAGLAFIGLGLGLFYSSNGI KELEYDYTGNPGTGDCSVCAAKGQGRAPPPGCACSWSFTLPELFPGPVYLYYELSNFYQN NRRYGVSRDDAQLSGLASALRHPANECAPYQFRSDGLPIAPCGAIANSLFNDSFSLWHQR QPSDPFVEVPLDRTAIAWWTDYHVKFRNPPLVNGSLALAFRGTAPPPNWHRPVYELSPDP NNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGTYRVNITYNYPVRAFGGHK LIILSNISWMGGKNPFLGIAYLVVGSLCIVMGFVMLVVYIRYQDQDDDDNDDE
Uniprot No.

Target Background

Function

This protein is an accessory component of a P4-ATPase flippase complex. It catalyzes ATP hydrolysis, coupled with the transport of aminophospholipids from the outer to the inner leaflet of various membranes. This maintains asymmetric phospholipid distribution. Phospholipid translocation is also implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit may facilitate phospholipid substrate binding. It can mediate the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, and ATP8B4 from the endoplasmic reticulum to the plasma membrane.

Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Tmem30b, and why is it significant in cell cycle control?

The significance of Tmem30b in cell cycle control lies in its ability to regulate phospholipid distribution, which is essential for processes such as membrane trafficking and signal transduction. Disruptions in these processes can lead to impaired cellular homeostasis and have been implicated in neurodegenerative diseases and metabolic disorders . Furthermore, Tmem30b's role in exporting alpha subunits like ATP8A1 and ATP8B4 from the endoplasmic reticulum to the plasma membrane underscores its importance in maintaining cellular integrity .

How is Tmem30b structurally characterized, and what are its key features?

Structurally, Tmem30b is a transmembrane protein with two transmembrane domains and an extracellular loop containing three cysteines and an N-glycosylation site . These features are critical for its function as part of the flippase complex. The protein's sequence comprises 351 amino acids, with both termini facing the cytoplasm—a topology that has been experimentally validated .

The low mobility of Tmem30b within membranes suggests it is tightly integrated into its lipid environment. This structural rigidity may be necessary for its role in phospholipid translocation and interaction with other flippase components . Additionally, Tmem30b belongs to the CDC50/LEM3 family, which is conserved across multiple species, indicating its evolutionary importance .

What experimental methods are commonly used to study Tmem30b's function?

Several experimental approaches have been employed to investigate Tmem30b:

  • Overexpression Studies: These are conducted in cell lines such as HEK293 and HK-2 to assess the functional impact of Tmem30b on cellular processes like vesicle formation and phospholipid asymmetry .

  • Western Blotting: Antibodies specific to Tmem30b are used to detect its expression levels across different tissues or under varying experimental conditions .

  • Cellular Localization Studies: Techniques such as GFP fusion tagging help determine Tmem30b's membrane orientation and subcellular localization (e.g., endoplasmic reticulum, Golgi apparatus) .

  • Mutagenesis: Site-directed mutagenesis can identify critical residues involved in Tmem30b's interaction with other proteins or lipids .

  • Protein Interaction Networks: Databases like STRING provide insights into potential functional partners of Tmem30b, such as ATP8B1 and ATP11C, which are catalytic components of related P4-ATPase complexes .

These methods collectively contribute to a detailed understanding of Tmem30b's role at molecular and cellular levels.

What are the known physiological roles of Tmem30b beyond phospholipid translocation?

Beyond its primary role in phospholipid translocation, Tmem30b contributes to several physiological processes:

  • Membrane Trafficking: By regulating vesicle formation, Tmem30b influences intracellular transport pathways critical for protein sorting and secretion .

  • Signal Transduction: The asymmetric distribution of lipids facilitated by Tmem30b affects signaling cascades that rely on specific lipid-protein interactions .

  • Cancer Biology: Recent studies have linked Tmem30b downregulation with advanced stages of clear cell renal cell carcinoma (ccRCC). Its expression levels correlate with clinical parameters like metastasis and patient survival rates .

  • Neurodegenerative Diseases: Mutations in P4-ATPases associated with Tmem30b have been implicated in disorders characterized by disrupted lipid metabolism .

These roles highlight the multifaceted contributions of Tmem30b to cellular physiology and pathology.

How does Tmem30b interact with other proteins within the P4-ATPase flippase complex?

Tmem30b acts as a beta subunit within the P4-ATPase flippase complex, facilitating the proper folding, stability, and plasma membrane localization of alpha subunits such as ATP8A1 and ATP8B4 . These interactions are crucial for the catalytic activity of the complex.

The beta subunit also plays a role in substrate binding, ensuring efficient phospholipid translocation. Functional studies using co-immunoprecipitation have confirmed these interactions, while computational models suggest that specific residues within Tmem30b mediate its binding affinity for alpha subunits .

What challenges exist in studying Tmem30b's role in disease models?

Studying Tmem30b's involvement in diseases poses several challenges:

Addressing these challenges will require integrative approaches combining genomics, proteomics, and advanced imaging techniques.

How can researchers design experiments to investigate contradictions in data regarding Tmem30b?

When faced with contradictory findings about Tmem30b's function or localization, researchers should consider the following strategies:

  • Standardize Experimental Conditions: Ensure consistency in cell lines used (e.g., HEK293 vs. primary cells) and experimental setups (e.g., overexpression vs. knockdown studies).

  • Use Complementary Techniques: Combine biochemical assays (e.g., Western blotting) with imaging-based methods (e.g., confocal microscopy) to validate results.

  • Control for Isoform-Specific Effects: Different isoforms of TMEM proteins may exhibit distinct functions; thus, isoform-specific reagents should be employed where possible.

  • Replicate Across Models: Conduct parallel experiments using both mouse models and human-derived cells to account for interspecies variability.

By adopting these methodological considerations, researchers can reconcile conflicting data and build a more cohesive understanding of Tmem30b.

What future directions should researchers pursue to expand our understanding of Tmem30b?

Future research on Tmem30b could focus on:

  • Structural Studies: High-resolution techniques like cryo-electron microscopy could elucidate the detailed architecture of the P4-ATPase flippase complex.

  • Pathophysiological Mechanisms: Investigating how alterations in Tmem30b expression or function contribute to diseases such as cancer or neurodegeneration.

  • Therapeutic Targeting: Exploring whether modulating Tmem30b activity can restore normal cellular functions in disease contexts.

  • Systems Biology Approaches: Integrating transcriptomic, proteomic, and metabolomic data to map Tmem30b's role within broader cellular networks.

These avenues hold promise for advancing both basic science and clinical applications related to this critical protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.