Recombinant Mouse Ceramide synthase 2 (Cers2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Ceramide Synthase 2

Recombinant Mouse Ceramide synthase 2 (Cers2) is a purified protein derived from the full-length mouse ceramide synthase 2 gene, typically expressed in HEK293T cells with C-terminal MYC/DDK tags for detection and purification purposes . As a specialized enzyme, Cers2 catalyzes the formation of ceramide molecules by facilitating the reaction between sphinganine and acyl-CoA substrates, demonstrating high selectivity toward very-long chain (C22:0-C24:0) fatty acyl donors . The recombinant form of this protein provides researchers with a reliable tool to study sphingolipid metabolism in controlled laboratory conditions. Ceramide synthase 2 belongs to a family of ceramide synthases that are critical for producing varied ceramide species with different fatty acid chain lengths, which subsequently influence membrane properties and cellular signaling pathways.

Expression and Purification Methods

The recombinant production of mouse Cers2 follows standardized protocols to ensure high purity and functional integrity. The protein is typically expressed in HEK293 cells, a human embryonic kidney cell line that provides the appropriate eukaryotic environment for proper folding and post-translational modifications . This expression system is preferred over bacterial expression systems due to the complex nature of Cers2 as a multi-pass transmembrane protein requiring proper membrane insertion and folding.

Purification Process

The purification of recombinant mouse Cers2 typically involves affinity chromatography utilizing the DDK tag, followed by additional conventional chromatography steps to achieve high purity . The standard purification protocol yields protein with greater than 80% purity as determined by SDS-PAGE and Coomassie blue staining . The final product is carefully formulated in a stabilizing buffer composed of 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol to maintain enzyme activity during storage .

Quality Control Parameters

Several quality control parameters are employed to ensure the consistency and functionality of purified recombinant mouse Cers2:

ParameterSpecificationMethod of Determination
Purity>80%SDS-PAGE/Coomassie blue staining
Concentration>50 μg/mLMicroplate BCA method
Molecular Mass45 kDaSDS-PAGE
Storage Buffer25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerolFormulation analysis
Stability12 months at -80°CAccelerated stability testing

These standardized parameters ensure that researchers receive consistent preparations of the recombinant protein for experimental applications .

Functional Properties and Enzymatic Activity

Recombinant mouse Cers2 demonstrates specific catalytic properties that define its role in sphingolipid metabolism. The enzyme primarily catalyzes the N-acylation of sphinganine (dihydrosphingosine) with very long-chain fatty acyl-CoAs, resulting in the formation of dihydroceramides . These dihydroceramides can subsequently be converted to ceramides through the action of dihydroceramide desaturases.

Substrate Specificity

A distinguishing characteristic of mouse Cers2 is its substrate specificity. Unlike other ceramide synthases, Cers2 exhibits high selectivity for very long-chain fatty acyl-CoA substrates, particularly those with 22 to 24 carbon atoms (C22:0-C24:0) . This specificity is critical for generating the appropriate ceramide species required for specific cellular functions, particularly in myelin formation and maintenance in the central nervous system.

Research using recombinant mouse Cers2 has demonstrated that this substrate specificity is intrinsic to the enzyme's structure and cannot be significantly altered by changing cellular environments. The preference for very long-chain fatty acids distinguishes Cers2 from other ceramide synthases like Cers1, which preferentially utilizes C18 fatty acyl-CoAs .

Tissue Distribution and Biological Functions

Understanding the tissue distribution of endogenous Cers2 provides context for applications of the recombinant protein in research models. In mice, Cers2 mRNA is widely distributed across multiple tissues, with particularly high expression in the liver and kidney . Within the mouse brain, Cers2 is predominantly expressed in white matter tracts, specifically in oligodendrocytes and Schwann cells responsible for myelin production .

Role in Myelination

Expression of Cers2 is transiently increased during periods of active myelination, suggesting a critical role in the synthesis of myelin sphingolipids . The very long-chain ceramides produced by Cers2 are essential components of myelin sheaths, contributing to their insulating properties and structural integrity. Research utilizing recombinant mouse Cers2 has helped elucidate these functions by enabling controlled enzymatic studies.

Applications in Research

Recombinant mouse Cers2 serves as a valuable tool for various research applications in sphingolipid biology and disease models. Its availability as a purified protein enables detailed biochemical characterization and functional studies that would be challenging to perform in complex cellular systems.

Enzymatic Assays

The purified recombinant protein facilitates in vitro enzymatic assays to assess ceramide synthase activity under various conditions. Researchers can manipulate substrate concentrations, cofactors, and potential inhibitors to understand the regulatory mechanisms controlling Cers2 activity. These assays are essential for drug discovery efforts targeting sphingolipid metabolism.

Rescue Experiments

A particularly innovative application of recombinant Cers2 has been demonstrated in rescue experiments using mouse models with deficiencies in other ceramide synthases. Ectopic expression of Cers2 in neurons of Cers1-deficient mice resulted in remarkable suppression of neurodegeneration, despite the inability of Cers2 to produce the C18 ceramides normally synthesized by Cers1 . This finding suggests that the neurodegeneration observed in Cers1-deficient mice may be primarily due to the accumulation of long-chain bases (LCBs) rather than the reduction in C18 ceramides .

Comparative Analysis with Human Ceramide Synthase 2

While mouse and human Cers2 share significant homology, understanding their differences is important for translational research. The recombinant forms of both proteins share similar molecular characteristics:

ParameterMouse Cers2Human Cers2
Expression HostHEK293HEK293T
TagMyc/DDKC-Myc/DDK
Molecular Mass45 kDa44.7 kDa
Storage Buffer25 mM Tris-HCl, pH 7.3, 100 mM glycine, 10% glycerol25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Purification MethodAnti-DDK affinity chromatographyAnti-DDK affinity column followed by conventional chromatography

Research Findings and Pathological Significance

Studies utilizing recombinant mouse Cers2 have contributed significantly to our understanding of sphingolipid metabolism and its implications in health and disease. One of the most intriguing findings emerged from studies of Cers1-deficient mice, which typically display severe neurodegeneration. Ectopic expression of Cers2 in neurons of these mice resulted in almost complete suppression of the mutant pathology .

Mechanistic Insights

Detailed sphingolipid profiling revealed that ectopic Cers2 expression did not restore the C18 ceramide levels (normally produced by Cers1) but instead reduced the accumulation of long-chain bases (LCBs) . This finding suggests that LCB accumulation, rather than ceramide reduction, may be the primary cause of neurodegeneration in Cers1 deficiency. The ability of Cers2 to rescue the Cers1 mutant phenotype despite its inability to produce C18 ceramides highlights the complex interplay between different ceramide species and their precursors in neuronal homeostasis .

Implications for Disease Models

The availability of recombinant mouse Cers2 has facilitated studies on its potential role in various pathological conditions. Alterations in Cers2 expression and activity have been implicated in several disease states, including cancer and metabolic disorders . In particular, Cers2 levels are significantly elevated in certain breast cancer tissues compared to normal tissue, suggesting a potential role in cancer progression .

The regulatory relationship between Cers2 and metabolic hormones has also been explored, with studies showing that leptin administration to rats induced a decrease in Cers2 in white adipose tissue, implicating this enzyme in the control of body weight . These findings highlight the potential of recombinant Cers2 as a target for therapeutic intervention in various disease contexts.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will accommodate your preferences whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cers2; Lass2; Trh3; Ceramide synthase 2; CerS2; LAG1 longevity assurance homolog 2; Sphingosine N-acyltransferase CERS2; Translocating chain-associating membrane protein homolog 3; TRAM homolog 3; Tumor metastasis-suppressor gene 1 protein; Very-long-chain ceramide synthase CERS2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cers2
Target Protein Sequence
MLQTLYDYFWWERLWLPVNLTWADLEDKDGRVYAKASDLYITLPLALLFLVIRYFFELYV ATPLAALLNVKEKTRLRAPPNATLEHFYQTSGKQPKQVEVDLLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTYYLIAFVAGMAVTVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILLCFSWFANYVRAGTLIMALHD ASDYLLESAKMFNYAGWKNTCNNLFIVFAIVFIITRLVIMPFWILHCTMIYPLELYPAFF GYYFFNFMMAVLQMLHIFWAYFILRMAHKFITGKLIEDERSDREETESSEGEETAAGAGA KSRLLANGHPILNNNHPKND
Uniprot No.

Target Background

Function
Ceramide synthase 2 (CerS2) is an enzyme that catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base. It exhibits high selectivity towards very-long-chain fatty acyl-CoA (chain length C22-C27). CerS2 N-acylates sphinganine and sphingosine bases to produce dihydroceramides and ceramides, respectively, in both de novo synthesis and salvage pathways. It plays a crucial non-redundant role in the synthesis of ceramides with very-long-chain fatty acids in the kidney, liver, and brain. CerS2 regulates the abundance of myelin-specific sphingolipids, galactosylceramide, and sulfatide, which influence myelin sheath architecture and motor neuron function.
Gene References Into Functions
  1. Gene expression analyses in livers of transgenic mouse mutants revealed that inactivation of CerS2 catalytic activity significantly affects transcription of genes involved in lipid metabolism and cell division. This is associated with the formation of hepatocellular carcinoma in 6 to 8-week-old mice. PMID: 29653252
  2. CerS2 deficiency impacts intestinal barrier function and the severity of experimental colitis, potentially contributing to inflammatory bowel disease pathogenesis. PMID: 28699686
  3. LASS2 plays a significant role in efficient liver regeneration in response to partial hepatectomy. PMID: 28958935
  4. Deletion of CerS2 significantly reduced very long-chain ceramides (Cer24:0, 24:1) but concomitantly increased long-chain ceramides and sphinganine in plasma and colon tissue. In naive CerS2(-/-) mice, the expression of tight junction proteins, including ZO-1, was almost completely lost in the colon epithelium, leading to increased membrane permeability. Ceramide synthase 2 deficiency aggravates dextran induced colitis in mice. PMID: 28405720
  5. This study demonstrates that Cers2 limits the levels of S1P in the thymus and blood to maintain functional S1P gradients that mediate thymocyte emigration into the circulation. PMID: 28198542
  6. The study found that only LCBs, the substrates common to all CerS isoforms, but not ceramides and complex sphingolipids, were restored to wild-type levels in the Cers2-rescued Cers1 mutant mouse brains. PMID: 27162368
  7. CerS1, -2, and -6 are hyperacetylated in the mitochondria of SIRT3-null mice. PMID: 26620563
  8. Haploinsufficiency for CerS2 altered the pattern of ceramide acylation in the liver without affecting total ceramide levels, replacing very-long-chain ceramides with long-chain C16-ceramides. PMID: 25295789
  9. Development of pheochromocytoma has been observed in ceramide synthase 2 null mice. PMID: 26113602
  10. The findings strongly indicate that G-CSF-induced CXCR2 expression is regulated in a CerS2-dependent manner. CerS2 promotes the migration of neutrophils, contributing to inflammation and the development of EAE and MS. PMID: 25697397
  11. This study represents the first comparison of spatial distribution between SM molecular species and CerS isoforms, revealing their distinct association in the brain. PMID: 26398595
  12. Data indicate that the augmented rate of death in ceramide synthase 2 (CerS2) null mice is due to elevated levels of tumor necrosis factor alpha (TNFalpha) secretion as a result of enhanced activity of TNFalpha-converting enzyme (TACE). PMID: 26183206
  13. CerS2-deficient kidneys were completely depleted of phytosphingosine-containing cortical sulfatides without any compensation. PMID: 25267995
  14. This study is the first to report that Lass2 deficiency caused the downregulation of miR-694 and the upregulation of its target gene Tnfaip3 in vivo in mice, which may be linked to a higher risk of hepatocellular carcinoma development. PMID: 25333455
  15. Identifying the specific cell types where CerS2 protein is expressed is crucial for further mechanistic characterization of the phenotypic abnormalities observed in CerS2-deficient mice. PMID: 23591958
  16. Lass2 is a protective gene against diethylnitrosamine-induced liver tumorigenesis. Upregulation of the TGF-beta1-Smad4-PAI-1 axis may contribute to the vulnerability of Lass2-knockout mice to diethylnitrosamine. PMID: 24337404
  17. A ceramide synthase 2 null mouse is protected from drug-induced liver injury, possibly due to gap junction dysfunction and connexin 32 mislocalization. PMID: 24019516
  18. This study explores the expression and role of ceramide synthase-2 in the lung. PMID: 23690971
  19. Ablation of ceramide synthase 2 leads to chronic oxidative stress due to disruption of the mitochondrial respiratory chain. PMID: 23283968
  20. Loss of ceramide synthase 2 alters lipid metabolic pathways by inhibiting very long acyl chain ceramide synthesis. PMID: 20110363
  21. Loss of CerS2 is associated with hepatocellular carcinoma and hepatomegaly. PMID: 20110366
  22. Results indicate that CERS2 activity supports various biological functions: maintenance of myelin, stabilization of cerebellar and renal histological architecture, and protection against hepatocarcinomas. PMID: 19801672
  23. CerS2 activity can be regulated by another bioactive sphingolipid, sphingosine 1-phosphate. PMID: 18165233

Show More

Hide All

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed, with highest levels in liver and kidney. In brain is detected in neurons, oligodentrocytes, ependymal cells and epithelial cells of the choroid plexus. In kidney is detected in collecting ducts and to a lesser degree in proximal tubules

Q&A

What is Ceramide synthase 2 (Cers2) and what is its primary function in biological systems?

Ceramide synthase 2 (Cers2) is an enzyme that catalyzes the transfer of acyl chains from acyl-CoA to sphingoid bases, producing ceramides with specific acyl chain lengths. It shows high selectivity toward very-long-chain fatty acyl-CoAs, particularly those with chain lengths of C22-C27. In mammals, Cers2 is part of a family of six ceramide synthases (Cers1-6), each with distinct substrate preferences and tissue distribution patterns. The primary function of Cers2 is to generate very-long-chain ceramides, which serve as essential components of complex sphingolipids involved in membrane structure and cellular signaling pathways .

To study Cers2 function, researchers typically use recombinant protein expression systems, gene knockout models, or overexpression studies. The recombinant protein approach allows for controlled in vitro analysis of enzymatic activity, while genetic models provide insights into physiological roles in vivo.

How does the structure of Cers2 relate to its catalytic function?

Cers2 is a transmembrane protein primarily localized to the endoplasmic reticulum. The human canonical protein consists of 380 amino acid residues with a molecular weight of approximately 44.9 kDa . The protein contains multiple transmembrane domains and a catalytic domain known as the Lag1p motif, which is essential for ceramide synthase activity.

The structural features of Cers2 that contribute to its substrate specificity for very-long-chain acyl-CoAs remain an active area of research. Current evidence suggests that specific amino acid residues within the catalytic domain create a binding pocket that preferentially accommodates C22-C27 acyl chains. Researchers investigating structure-function relationships often use site-directed mutagenesis of recombinant Cers2 to identify critical residues involved in substrate recognition and catalytic activity.

What is the expression pattern of Cers2 across different tissues and how does this inform its biological role?

Cers2 exhibits a broad expression pattern across multiple tissues. In humans, high expression levels are reported in the kidney, liver, brain, heart, placenta, and lung . Within the brain, Cers2 is predominantly expressed in oligodendrocytes rather than neurons, which is significant for understanding its role in central nervous system biology .

This distinct expression pattern suggests tissue-specific functions for Cers2-generated ceramides. For instance, the high expression in liver correlates with the abundance of very-long-chain sphingolipids in this tissue, which are crucial for maintaining proper membrane properties of hepatocytes. Similarly, Cers2 expression in oligodendrocytes contributes to the production of specialized sphingolipids required for myelin structure and function.

Researchers studying tissue-specific roles should consider using conditional knockout models that target Cers2 deletion in specific cell types rather than global knockouts, which may have widespread and complex phenotypes.

What transgenic mouse models are available for studying Cers2 function and what are their key phenotypes?

Several transgenic mouse models have been developed to study Cers2 function:

  • Cers2 knockout mice (Cers2-/-): These mice show complete absence of Cers2 expression and exhibit multiple phenotypes including reduced body size, hepatic dysfunction, and myelin abnormalities.

  • Cers1to/to;Tg-Cers2 mice: This model features ectopic expression of Cers2 in neurons of Cers1 mutant mice. Interestingly, while Cers1 deficiency leads to neurodegeneration, the addition of the Cers2 transgene suppresses this phenotype, suggesting functional compensation between ceramide synthases under certain conditions .

When working with these models, researchers should consider the following methodological approaches:

  • Confirm genotype using PCR and verify protein expression levels using Western blotting

  • Conduct lipid profiling using mass spectrometry to characterize changes in sphingolipid composition

  • Employ tissue-specific analyses to identify cell-autonomous versus non-cell-autonomous effects

How does ectopic expression of Cers2 affect sphingolipid metabolism in neuronal cells?

Ectopic expression of Cers2 in neurons, which normally express primarily Cers1, leads to significant alterations in sphingolipid metabolism. Research with the Cers1to/to;Tg-Cers2 mouse model revealed that neuronal Cers2 expression did not significantly change the total level or fatty acyl chain length profiles of ceramides and sphingomyelins compared to the Cers1 mutant .

  • Significant elevation of C22 and C24:1 hexosylceramides

  • Increase in total hexosylceramide levels

  • Significant increase in C22 and C24 lactosylceramide species

These findings suggest that the very-long-chain ceramides produced by ectopically expressed Cers2 are preferentially channeled into glycosphingolipids rather than sphingomyelin . This selective incorporation indicates distinct metabolic fates for different ceramide species based on their acyl chain length, which has important implications for understanding the role of specific ceramides in neuronal function and neuropathology.

Researchers studying the effects of Cers2 expression should employ comprehensive lipidomic analyses to capture the complex changes across multiple sphingolipid classes rather than focusing solely on ceramide levels.

What is the role of Cers2-generated ceramides in immune cell function and inflammatory responses?

Cers2 plays a significant role in immune cell function, particularly in neutrophil migration and inflammatory responses. Studies in experimental autoimmune encephalomyelitis (EAE), an animal model of multiple sclerosis, have shown that ablation of Cers2 suppresses EAE pathology by reducing neutrophil migration into the central nervous system .

The mechanism involves G-CSF signaling, which normally leads to a cascade including:

  • Phosphorylation of Lyn kinase and STAT3

  • Regulation of chemokine receptor 2 (CXCR2) expression

  • Translocation of the receptor into detergent-resistant membranes (DRMs)

In Cers2 null bone marrow cells (BMCs), G-CSF fails to induce translocation of G-CSF receptor (G-CSF-R) into DRMs, leading to reduced phosphorylation of Lyn and reduced CXCR2 expression . This demonstrates that very-long-chain ceramides generated by Cers2 are critical for proper G-CSF signaling and neutrophil function.

For researchers studying immune cell function, methods to consider include:

  • Flow cytometry to assess cell surface receptor expression

  • Membrane fractionation to analyze protein localization in DRMs

  • Phospho-specific Western blotting to evaluate signaling pathway activation

  • In vitro and in vivo migration assays to assess functional consequences

What expression systems are optimal for producing functional recombinant mouse Cers2?

For producing functional recombinant mouse Cers2, several expression systems have been successfully employed, each with distinct advantages:

  • Mammalian expression systems (e.g., HEK293T cells): These provide proper post-translational modifications and membrane insertion, resulting in highly active enzyme. Human recombinant Cers2 has been successfully expressed in HEK293T cells with C-Myc/DDK tags, yielding protein with a predicted molecular weight of 44.7 kDa .

  • Insect cell systems (e.g., Sf9 cells): These provide high expression levels while maintaining most post-translational modifications required for activity.

  • Yeast expression systems: Useful for functional complementation studies, as yeast have simpler sphingolipid metabolism.

For optimal expression of functional Cers2, researchers should consider:

  • Using full-length cDNA with intact transmembrane domains

  • Including epitope tags (e.g., C-Myc/DDK) for purification and detection

  • Employing detergent extraction methods optimized for membrane proteins

  • Verifying enzyme activity using in vitro assays with appropriate acyl-CoA substrates

What are the optimal conditions for purification, storage, and handling of recombinant Cers2?

Proper handling of recombinant Cers2 is critical for maintaining its enzymatic activity:

Purification:

  • Affinity chromatography using anti-tag antibodies (e.g., anti-DDK) followed by conventional chromatography steps

  • Gentle detergent solubilization to maintain protein structure and activity

  • Inclusion of protease inhibitors throughout the purification process

Buffer Conditions:

  • 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol

  • The addition of glycerol helps stabilize the protein structure

Storage:

  • Store at -80°C for long-term preservation

  • Avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of activity

  • Aliquot the protein solution before freezing to minimize freeze-thaw cycles

Handling:

  • For cell culture applications, filter the protein solution before use (note that some protein loss may occur during filtration)

  • Maintain protein concentration >0.05 μg/μL for stability

  • Verify protein purity (>80%) using SDS-PAGE and Coomassie blue staining

What are the most effective analytical techniques for studying Cers2-generated sphingolipids?

Several analytical techniques are particularly valuable for studying Cers2-generated sphingolipids:

  • Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

    • Provides detailed characterization of sphingolipid species

    • Enables quantification of ceramides with different acyl chain lengths

    • Can detect changes in both ceramides and complex sphingolipids derived from them

  • Thin Layer Chromatography (TLC):

    • Useful for rapid screening of major sphingolipid classes

    • Can be combined with radioactive labeling for metabolic studies

  • Fluorescence-based assays:

    • Utilize fluorescently labeled sphingoid bases to track ceramide synthesis

    • Allow for high-throughput screening applications

When analyzing sphingolipids in biological samples, researchers should:

  • Include internal standards for accurate quantification

  • Consider extraction methods that efficiently recover very-long-chain sphingolipids

  • Analyze both simple sphingolipids (ceramides) and complex sphingolipids (sphingomyelins, hexosylceramides, lactosylceramides)

  • Compare profiles across multiple sphingolipid classes to understand metabolic channeling

How can researchers effectively design experiments to study the specific role of Cers2 in membrane organization?

To study Cers2's role in membrane organization, researchers should consider the following experimental approaches:

  • Detergent-resistant membrane (DRM) isolation:

    • Useful for studying protein localization in membrane microdomains

    • Critical for understanding how Cers2-generated ceramides affect receptor signaling

    • Has revealed that G-CSF receptor translocation into DRMs depends on Cers2-generated very-long-chain ceramides

  • Membrane fluidity and biophysical studies:

    • Techniques such as fluorescence anisotropy or fluorescence recovery after photobleaching (FRAP)

    • Atomic force microscopy to examine membrane domain formation

    • Analysis of lipid packing in model membranes with defined ceramide compositions

  • Protein-lipid interaction studies:

    • Lipidomic analysis of immunoprecipitated membrane proteins

    • Lipid overlay assays to identify proteins that bind specifically to very-long-chain ceramides

    • Photoactivatable lipid analogs for in situ identification of ceramide-interacting proteins

Experimental design considerations should include:

  • Comparison between wild-type and Cers2-deficient cells/tissues

  • Use of specific inhibitors that target Cers2 without affecting other ceramide synthases

  • Analysis of effects on membrane protein clustering and lateral mobility

What is the relationship between Cers2 activity and other sphingolipid metabolic enzymes?

Cers2 functions within a complex network of sphingolipid metabolic enzymes, and its activity can influence and be influenced by other enzymes in the pathway:

  • Substrate competition:

    • Cers2 competes with other ceramide synthases (Cers1-6) for sphingoid base substrates

    • Changes in Cers2 expression can alter substrate availability for other ceramide synthases

  • Metabolic channeling:

    • Cers2-generated very-long-chain ceramides are preferentially incorporated into glycosphingolipids rather than sphingomyelins

    • This suggests coordination between Cers2 and specific glycosphingolipid synthases

  • Compensatory mechanisms:

    • Ectopic expression of Cers2 can partially compensate for Cers1 deficiency in neurons, suggesting functional overlap despite different substrate preferences

    • This compensatory effect likely involves complex cross-talk between different branches of sphingolipid metabolism

To study these relationships, researchers should:

  • Perform comprehensive lipidomic analyses across multiple sphingolipid classes

  • Use genetic models with manipulation of multiple sphingolipid enzymes

  • Conduct metabolic labeling studies to track the flow of metabolites through different pathways

  • Analyze enzyme expression levels to identify compensatory transcriptional responses

How does Cers2 function relate to neurodegenerative disease models?

Cers2 has important implications for neurodegenerative disease research:

  • Protective effects in neurodegeneration:

    • Ectopic expression of Cers2 in neurons suppresses the neurodegenerative phenotype observed in Cers1-deficient mice

    • This suggests potential therapeutic applications for modulating ceramide synthase activity in neurodegenerative conditions

  • Impact on sphingolipid profiles:

    • In Cers1to/to;Tg-Cers2 mice, neuronal Cers2 expression significantly alters hexosylceramide and lactosylceramide profiles without substantially changing ceramide levels

    • This indicates that the protective effect may be related to changes in complex sphingolipids rather than ceramides themselves

  • Experimental autoimmune encephalomyelitis (EAE) models:

    • Ablation of Cers2 suppresses EAE pathology by reducing neutrophil migration into the central nervous system

    • This demonstrates a role for Cers2 in neuroinflammatory processes relevant to multiple sclerosis

Methodological approaches for studying Cers2 in neurodegenerative contexts include:

  • Behavioral testing to assess neurological function

  • Histopathological analysis of neuronal loss and inflammation

  • Electrophysiological studies to measure neuronal activity

  • Cell-type-specific manipulation of Cers2 expression to distinguish direct versus indirect effects

Comparative properties of recombinant Cers2 protein preparations

PropertyHuman Recombinant CERS2Typical Mouse Recombinant CERS2
Expression HostHEK293THEK293T or Sf9 cells
Molecular Weight44.7 kDa44.5 kDa
TagsC-Myc/DDKHis, GST, or FLAG
Buffer Composition25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerolSimilar, with variations in salt concentration
Storage Temperature-80°C-80°C
Stability12 months with proper storage6-12 months depending on preparation
Purity>80% by SDS-PAGETypically >75% by SDS-PAGE
Substrate PreferenceVery-long-chain acyl-CoAs (C22-C27)Very-long-chain acyl-CoAs (C22-C26)

Data compiled from available recombinant protein specifications .

Sphingolipid changes in Cers2 transgenic mouse models

Sphingolipid SpeciesWild-typeCers1to/toCers1to/to;Tg-Cers2Significance
C18 CeramideNormalDecreasedDecreasedNot rescued by Cers2 expression
C22 CeramideNormalNormalSlightly increasedMinor effect of Cers2 expression
C24 CeramideNormalNormalSlightly increasedMinor effect of Cers2 expression
C22 HexosylceramideNormalNormalSignificantly increasedMajor target of Cers2 activity
C24:1 HexosylceramideNormalNormalSignificantly increasedMajor target of Cers2 activity
Total HexosylceramideNormalNormalIncreasedCumulative effect of Cers2 expression
C22 LactosylceramideNormalNormalSignificantly increasedSpecific effect of Cers2 expression
C24 LactosylceramideNormalNormalSignificantly increasedSpecific effect of Cers2 expression
Total LactosylceramideNormalNormalNot significantly differentComplex regulation of synthesis

Data summarized from experimental findings in transgenic mouse models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.