Recombinant Mouse Ceramide synthase 4 (Cers4)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Substrate Specificity

Cers4 catalyzes the synthesis of ceramides with long-chain fatty acids, particularly C18:0–C22:0, which are essential for membrane fluidity and signaling. These ceramides serve as precursors for sphingomyelins, structural components of lipid rafts. In hair follicle stem cells (HFSCs), Cers4 maintains membrane lipid homeostasis by balancing ceramide C20:0 (associated with stemness) and ceramide C16:0 (linked to differentiation) .

Lipid SpeciesWT OrganoidsCers4-deficient OrganoidsFunctional Impact
Ceramide C20:0High↓ (trend)Reduced stemness
Ceramide C16:0LowEnhanced differentiation
Sphingomyelin C18:0HighAltered membrane signaling

Data derived from lipidomic analyses of Cers4-deficient vs. control organoids .

Role in Stem Cell Homeostasis and Skin Barrier Function

Cers4 regulates HFSC behavior through noncanonical Wnt/Ca²⁺ signaling. Its deletion disrupts HFSC compartmentalization, leading to exhaustion and hair loss in aged mice. Key findings include:

  • Aberrant Wnt signaling: Hyperactivation of noncanonical Wnt/Ca²⁺ pathways via increased intracellular Ca²⁺ oscillations .

  • Skin barrier dysfunction: Disrupted stratum corneum integrity, mimicking atopic dermatitis (AD), with Th2-dominated immune infiltration .

Experimental Models:

ModelObservationSource
Cers4⁻/⁻ MicePremature HFSC activation, expanded Lrig1⁺ junctional zone, sebaceous gland hyperplasia
Organoid CulturesReduced HFSC proliferation, impaired growth, and altered morphology

Implications in Cancer and NF-κB Signaling

Cers4 promotes hepatocellular carcinoma (HCC) progression by modulating the NF-κB pathway. Its knockdown suppresses tumor growth and proliferation:

Experimental ApproachOutcomeSource
CERS4 Silencing↓ Proliferation in HepG2/Huh7 cells (MTT assay), ↓ tumor volume in xenografts
NF-κB Pathway Analysis↓ Nuclear NF-κB, ↑ Cytoplasmic NF-κB; ↓ Ikbkg/Tank mRNA (NF-κB regulators)

Mechanistic Insight: CERS4 facilitates NF-κB nuclear translocation, enhancing pro-survival and proliferative signals in HCC cells .

Therapeutic and Diagnostic Potential

Disease ContextCers4’s RolePotential Target
Atopic DermatitisHFSC dysfunction → barrier loss → AD-like immune responseCeramide replacement therapy
Liver CancerNF-κB-mediated proliferation → Tumor growthCERS4 inhibitors

Research Methodologies and Experimental Models

Recombinant Cers4 has been utilized in:

  • Organoid systems: To study HFSC differentiation and lipid metabolism .

  • Knockdown/Rescue Experiments: Lentiviral shRNA for HCC studies; HALO-tagged CerS4 for localization studies .

  • Lipidomic Profiling: LC-MS/MS to quantify ceramides/sphingomyelins in Cers4-deficient models .

Key Research Findings

StudyKey DiscoveryImpact
Skin HomeostasisCers4 loss → Th2 immune dominance → AD-like phenotypeLinking lipid metabolism to immunity
Cancer BiologyCERS4 → NF-κB activation → HCC growthTherapeutic target validation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
Cers4; Lass4; Trh1; Ceramide synthase 4; CerS4; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4; Translocating chain-associating membrane protein homolog 1; TRAM homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cers4
Target Protein Sequence
MSFSLSEWLWQETYWLPPNVTWAELEDRDGLVFAHPHHVLAAFPVALVLVAVRIVFERFV ALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEETQMVLLASQCGLTLRQTQRWFRR RRNQDRPSLSKKFCEACWRFVFYLCSFVGGTSILYHESWLWSPSLCWENYPHQTLNLSLY WWYLLELGFYLSLLITLPFDVKRKDFKEQVVHHFVAVGLIGFSYSVNLLRIGAVVLLLHD CSDYLLEGCKILNYAHFRRGCDALFIMFALVFFYTRLIFFPTQVIYTSVYDSIKNSGPFF GYYFFIVLLVMLQILHVYWFCLILRMLYSFLHKGQMTEDIRSDVEEPDSSDDEPVSEGPQ LKNGMARGSRVAVTNGPRSRAAACLTNGHTRAT
Uniprot No.

Target Background

Function
Ceramide synthase 4 (CerS4) catalyzes the formation of ceramide from sphinganine and acyl-CoA substrates, exhibiting high selectivity for long and very-long chain (C18:0-C22:0) acyl donors.
Gene References Into Functions
  1. Phosphorylation of ceramide synthases is a crucial regulatory mechanism controlling the distribution and levels of sphingolipids with varying acyl-chain lengths. PMID: 26887952
  2. CerS4-mediated epidermal ceramide composition regulates hair follicle stem and progenitor cell behavior, potentially through BMP and Wnt signaling modulation. PMID: 25705848
  3. CerS4 protein deficiency alters sebum lipid composition, leading to solidification and potential hair loss due to hair canal blockage. PMID: 24738593
  4. Oxidized phospholipids (OxPLs) stimulate ceramide synthases (CerS1-CerS6) activity in macrophages, resulting in ceramide accumulation. PMID: 23936132
  5. Lag1p family members TRH1 and TRH4 regulate (dihydro)ceramide synthases, impacting the production of sphingolipids with diverse fatty acids. PMID: 12912983
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in skin.

Q&A

What is the functional role of CERS4 in sphingolipid metabolism?

CERS4 catalyzes an amide bond formation between a sphingoid base and a fatty acyl-coenzyme A during ceramide synthesis . It specifically participates in the N-acylation of sphinganine to dihydroceramide, which is subsequently reduced to ceramide by dihydroceramide desaturase . This reaction represents a critical step in de novo ceramide synthesis, which begins in the endoplasmic reticulum with the condensation of L-serine and palmitoyl-CoA by serine palmitoyl transferase . CERS4, like other ceramide synthases, has specificity for certain fatty acyl chain lengths, contributing to the diversity of ceramide species in cellular membranes .

How is CERS4 expression measured in research settings?

CERS4 expression is typically measured using multiple complementary techniques:

  • Transcriptional level analysis: Reverse transcription polymerase chain reaction (RT-PCR) and quantitative PCR (qPCR) are employed to assess mRNA levels .

  • Protein level analysis: Western blot analysis using specific anti-CERS4 antibodies (e.g., ab118379 from Abcam at 1:2,000 dilution) is commonly used .

  • Clinical sample analysis: For determining optimal expression cut-off values in disease studies, ROC analyses may be performed. In colorectal cancer research, a CERS4 cut-off value of 0.800 produced optimal results with an AUC of 0.694 (sensitivity: 0.83, specificity: 0.35) .

Where is CERS4 localized in mammalian cells?

CERS4 is primarily localized in the endoplasmic reticulum (ER) membrane . This localization is consistent with its role in de novo ceramide synthesis, where sphinganine is acylated to form dihydroceramide. After ceramide synthesis in the ER, the product is transported to the Golgi apparatus via vesicular trafficking or by the ceramide transfer protein (CERT) for further metabolism into complex sphingolipids . In specific tissues, CERS4 shows distinct expression patterns - it is highly expressed in the epidermis of adult mice and is localized in defined populations within the interfollicular epidermis and hair follicle sebaceous unit .

How can CERS4 activity be measured in vitro?

Measuring CERS4 activity in vitro involves several methodological approaches:

  • Enzymatic assays: Incubating purified recombinant enzyme or cell lysates with sphinganine and specific acyl-CoA substrates, followed by lipid extraction and analysis of dihydroceramide production.

  • Analytical techniques: Products can be measured using thin-layer chromatography (TLC), high-performance liquid chromatography (HPLC), or liquid chromatography-mass spectrometry (LC-MS).

  • Cell-based assays: For evaluating CERS4 function in cellular contexts, metabolic labeling with radiolabeled precursors can track ceramide synthesis.

  • Colony formation assays: As demonstrated in HepG2 liver cancer cells, where cells are plated (500 cells/well), cultured for ~2 weeks, stained with crystal violet solution (1% crystal violet and 10% ethanol), and colonies counted to assess proliferation capacity following CERS4 modulation .

What is the relationship between CERS4 expression and KRAS mutations in cancer models?

Research has revealed a significant inverse relationship between CERS4 expression and KRAS mutations in colorectal cancer (CRC). Key findings include:

  • CERS4 expression is significantly lower in KRAS-mutant CRC compared to wild-type KRAS CRC tissues (p = 0.004) .

  • ROC analyses established an optimal cut-off value of 0.800 for CERS4 expression, with an AUC of 0.694 (sensitivity: 0.83, specificity: 0.35) .

  • This relationship suggests CERS4 may function as a potential biomarker for KRAS mutation status in CRC .

Two potential mechanisms have been proposed to explain this relationship:

  • The Wnt pathway may be involved in both CERS4 regulation and KRAS mutation in CRC.

  • Direct signaling interactions might exist between KRAS and ceramide metabolism pathways .

Understanding this relationship could be crucial for developing targeted therapies for KRAS-mutant cancers, which are often resistant to standard treatments like cetuximab .

How does CERS4 regulate tumor growth and proliferation?

CERS4 plays significant roles in regulating tumor growth and proliferation through several mechanisms:

  • In liver cancer: High CERS4 expression correlates with increased cell proliferation. When CERS4 is silenced in HepG2 and Huh7 liver cancer cells, proliferation rates are significantly suppressed (p<0.001) .

  • In vivo effects: Silencing CERS4 in liver cancer cells leads to reduced tumor weight and volume in Balb/c nude mice models .

  • Molecular pathway involvement: The NF-κB signaling pathway is affected following CERS4 knockdown, suggesting this pathway mediates some of CERS4's proliferative effects .

  • Sphingolipid balance: CERS4 may modulate the balance between pro-apoptotic ceramides and pro-survival sphingolipid metabolites.

These findings indicate that CERS4 is an important regulator of liver cancer cell proliferation and could serve as a potential anticancer therapeutic target and diagnostic biomarker .

What is the relationship between CERS4 and vascular invasion in cancer?

CERS4 expression correlates with vascular invasion in colorectal cancer:

  • Clinical studies show that high CERS4 expression is associated with increased vascular invasion in colorectal cancer patients (p = 0.0057) .

  • The mechanism appears to involve sphingolipid-mediated effects on vascular integrity.

  • Ceramides produced by CERS4 are precursors to sphingosine-1-phosphate (S1P), a blood-borne lipid mediator that regulates vascular systems .

  • Blood flow and circulating S1P activate endothelial S1P1 receptors to stabilize blood vessels in development and homeostasis .

  • When CERS4 expression is reduced (as in KRAS-mutant cancers), ceramide levels decrease, potentially affecting downstream S1P production and vascular stability.

  • Paradoxically, among CRCs with decreased CERS4, there were significantly more cases with venous invasion than in cases where CERS4 was not decreased .

This complex relationship suggests CERS4's dual role in tumor progression and vascular invasion, making it an important target for understanding cancer metastasis.

How does CERS4 relate to the Wnt/β-catenin signaling pathway?

The connection between CERS4 and the Wnt/β-catenin signaling pathway has been observed in experimental models:

  • Studies in mice showed that decreased bone morphogenetic protein (BMP) signaling in CERS4−/− mice may promote Wnt/β-catenin signaling .

  • This enhanced Wnt activity strongly stimulates the activation of hair follicle stem cells .

  • In colorectal cancer contexts, where Wnt pathway dysregulation is a key driver of carcinogenesis, reduced CERS4 expression in KRAS-mutant tumors suggests a potential regulatory relationship with Wnt signaling .

  • While direct mechanistic evidence linking CERS4 suppression to Wnt pathway activation in colorectal cancer is still being investigated, it represents a plausible hypothesis for how CERS4 influences cancer development .

What experimental approaches are used to study CERS4 function in cancer models?

Several experimental approaches have been employed to study CERS4 function in cancer:

Cell Culture Studies:

  • Human cancer cell lines (HepG2 and Huh7 for liver cancer, various CRC lines)

  • Lentivirus-mediated RNA interference to silence CERS4 expression

  • MTT assays to measure cell proliferation at multiple time points (12, 24, 48, 72, and 96 hours)

  • Colony formation assays using crystal violet staining

Protein Analysis:

  • Western blotting with specific antibodies (anti-CERS4 at 1:2,000 dilution)

  • Analysis of related signaling pathways (e.g., NF-κB)

In Vivo Models:

  • Balb/c nude mice with xenografts of CERS4-silenced cancer cells

  • Measurement of tumor weight and volume

Clinical Samples:

  • Analysis of CERS4 expression in patient tumor samples

  • Correlation with clinical features including KRAS mutation status and vascular invasion

These diverse approaches provide complementary insights into CERS4's multifaceted roles in cancer biology.

What are the effects of CERS4 inhibition in different experimental models?

CERS4 inhibition produces diverse effects across different experimental models:

Experimental ModelMethod of CERS4 InhibitionObserved EffectsStatistical SignificanceReference
HepG2 liver cancer cellsLentivirus-mediated RNA interferenceReduced proliferation ratesp<0.001
Huh7 liver cancer cellsLentivirus-mediated RNA interferenceDecreased proliferationp<0.001
HepG2 cells - colony formationCERS4 silencingReduced colony numbersVisually significant
Balb/c nude mice xenograftsCERS4-silenced cancer cellsReduced tumor weight and volumeStatistically significant
Molecular signalingCERS4 knockdownAltered NF-κB signaling pathwayDemonstrated by protein analysis

These results highlight CERS4 as an important regulator of cancer cell proliferation and tumor growth, suggesting its potential as a therapeutic target.

How do ceramide synthases like CERS4 contribute to cancer and tumor suppression?

Ceramide synthases, including CERS4, play complex roles in cancer development and suppression:

  • Different CerS display remarkable differences in their biological properties, with each playing distinct roles in cancer and tumor suppression .

  • CERS4 appears to have context-dependent effects, functioning as a potential oncogenic factor in liver cancer, where its high expression correlates with increased proliferation .

  • In colorectal cancer with KRAS mutations, reduced CERS4 expression correlates with disease characteristics, suggesting tumor-suppressive functions in certain contexts .

  • The diverse effects stem from ceramide's role as an important intracellular signaling molecule involved in regulating differentiation, proliferation, and apoptosis .

  • Ceramide synthases influence the response to chemotherapeutic drugs and apoptotic processes, with specific ceramide chain lengths produced by different CerS having distinct biological effects .

This dual nature of CERS4 in different cancer types highlights the complexity of sphingolipid metabolism in tumorigenesis and the need for context-specific therapeutic approaches.

What methodological considerations are important when working with recombinant mouse CERS4?

When working with recombinant mouse CERS4, several methodological considerations are critical:

  • Expression systems: As a multi-pass membrane protein, CERS4 requires appropriate expression systems that support proper membrane integration and folding.

  • Enzymatic activity assays: When assessing activity, researchers should:

    • Ensure proper membrane reconstitution, as CERS4 requires a lipid bilayer environment for optimal activity

    • Consider using radiolabeled substrates ([³H]-sphinganine or [¹⁴C]-acyl-CoA) for enhanced sensitivity

    • Employ appropriate analytical techniques (LC-MS, TLC) to identify specific ceramide species produced

  • Genetic manipulation approaches:

    • Lentivirus-mediated RNA interference has been successfully used to silence CERS4 expression in cancer cell lines

    • For functional studies, knockdown should be validated at both mRNA (RT-PCR) and protein levels (Western blot)

  • Cell-based experimental design:

    • When assessing proliferation effects, measurements should be taken at multiple time points (e.g., 12, 24, 48, 72, and 96 hours as demonstrated in liver cancer studies)

    • Colony formation assays require proper cell seeding density (e.g., 500 cells/well) and sufficient incubation time (~2 weeks)

  • In vivo approaches:

    • Consider using immunodeficient mouse models (e.g., Balb/c nude mice) for xenograft studies of CERS4-manipulated cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.