Recombinant Mouse Ceramide synthase 5 (Cers5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cers5; Lass5; Trh4; Ceramide synthase 5; CerS5; LAG1 longevity assurance homolog 5; Sphingoid base N-palmitoyltransferase CERS5; Sphingosine N-acyltransferase CERS5; Translocating chain-associating membrane protein homolog 4; TRAM homolog 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-414
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cers5
Target Protein Sequence
MATAAAETLGLLWGWLWSESFWLPQNVSWADLEGPGDGYGYPRAQHVLSVFPLAVCIFSV RMLFERFIAKPCALRVGIKDSPVNKVEPNDTLEKVFVSVTKYPDEKRLKGLSKQLDWSVR KIQCWFRHRRNQDKPPTLTKFCESMWRFTYYLCIFCYGIRFLWSMPWFWDTRQCWYNYPY QPLSRELYYYYITQLAFYWSLMFSQFIDVKRKDFLMMFIHHMIGIMLTTFSYVNNMVRVG ALIFCLHDFADPLLEAAKMANYARRERLCTTLFVIFGAAFIVSRLAIFPLWILNTTLFES WEIIGPYPSWWLFNALLLILQVLHAIWSYLIVQTASKALSRGKVSKDDRSDVESSSEEED ETTHKNNLSGSSSSNGANCMNGYMGGSHLAEEQGTCKATGNLHFRASPHLHSCD
Uniprot No.

Target Background

Function
Ceramide synthase 5 (Cers5) is an enzyme that catalyzes the transfer of an acyl chain from acyl-CoA to a sphingoid base. Cers5 exhibits high selectivity towards palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA). While it can utilize other acyl donors, its efficiency is lower. Cers5 participates in the de novo synthesis and salvage pathways, N-acylating sphinganine and sphingosine bases to form dihydroceramides and ceramides, respectively. It plays a crucial role in de novo ceramide synthesis and surfactant homeostasis in pulmonary epithelia.
Gene References Into Functions
  1. Phosphorylation of ceramide synthases appears to be a key regulatory mechanism in controlling the distribution and levels of sphingolipids with various acyl chain lengths. PMID: 26887952
  2. Ceramide synthase 5 is essential for maintaining C16:0-ceramide pools and contributes to the development of diet-induced obesity. PMID: 26853464
  3. Transfection of Lass5 cDNA or pulse of Lass5 peptide onto B7-1 positive RMA-S cells overcomes the requirement for the B7-1/CD28 signal for T effector response. PMID: 25383875
  4. Research suggests that oxidized phospholipids (OxPLs)-induced ceramide synthases (CerS1-Cers6) activity in macrophages is responsible for the accumulation of ceramide. PMID: 23936132
  5. Ceramide synthase 5 mediates lipid-induced autophagy and hypertrophy in cardiomyocytes. PMID: 23023704
  6. Lag1p family members trh1 and trh4 regulate (dihydro)ceramide synthases responsible for the production of sphingolipids containing different fatty acids. PMID: 12912983
  7. LASS5 is the primary ceramide synthase gene product involved in sphingolipid production, which may also regulate phosphatidylcholine metabolism in pulmonary epithelia. PMID: 15772421

Show More

Hide All

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in testis and kidney. Expressed in pulmonary epithelia.

Q&A

What is Ceramide synthase 5 and how does it differ from other ceramide synthases?

Ceramide synthase 5 (CerS5) belongs to a family of six ceramide synthases (CerS1-6) in mammals that catalyze the N-acylation of sphingoid bases to form ceramides. Each CerS exhibits distinct substrate preferences and tissue distribution. CerS5 primarily synthesizes C16:0 ceramides by transferring the acyl chain from acyl-CoA to sphingoid bases .

While CerS5 shares functional similarity with CerS6 in producing C16:0 ceramides, their tissue distribution differs significantly. CerS1 predominantly generates C18 ceramides, CerS2 synthesizes C22-C24 ceramides, CerS3 produces very long-chain ceramides (>C26), and CerS4 creates C18-C20 ceramides . Unlike other family members, CerS5's homeodomain appears non-essential for its enzymatic activity, though two positively charged amino acids following this domain are crucial for function .

What tissues express significant levels of CerS5 and what are its primary physiological roles?

CerS5 is essential for maintaining cellular C16:0 sphingolipid pools in multiple tissues including lung, spleen, muscle, liver, and white adipose tissue . It serves as the major ceramide synthase in lung epithelial cells and has been suggested to regulate phosphatidylcholine synthesis, the predominant lipid class in surfactant lipids .

In cardiac tissue, CerS5 mediates lipid-induced autophagy and hypertrophy, with its expression significantly affecting BECN1 (Beclin 1) regulation . CerS5 also plays crucial roles in retinal function, where it has shown the ability to compensate for ceramide deficiencies in retinal dystrophy models . The tissue-specific functions of CerS5 are particularly evident in metabolic contexts, where it strongly impacts white adipose tissue ceramide levels during high-fat diet feeding .

How does CerS5 contribute to metabolic disorders and insulin resistance?

Research using CerS5 knockout (CerS5-/-) mice has revealed that CerS5-dependent ceramide synthesis significantly impacts white adipose tissue after high-fat diet feeding. The loss of CerS5 affects C16:0-ceramide levels in multiple metabolic tissues including skeletal muscle, liver, and spleen, independent of feeding conditions . This suggests CerS5-derived ceramides play a tissue-specific role in metabolic regulation.

CerS5-mediated ceramide production contributes to obesity development and insulin resistance, although the exact mechanisms remain under investigation. The enzyme appears to function in TLR4 signaling-dependent pathways and is required for lipid-induced insulin resistance in myotubes, though not for TNFα release from macrophages . These findings highlight CerS5 as a potential therapeutic target for metabolic disorders.

What role does CerS5 play in cardiovascular pathologies?

CerS5 has emerged as a critical mediator in the development of cardiovascular conditions, particularly aortic valve stenosis (AVS). In a wire injury model using wild-type and CerS5-/- mice on Western diet, CerS5 deficiency resulted in:

  • Reduced peak velocity (indicating less severe AVS)

  • Decreased immune cell infiltration (measured by CD68 staining)

  • Lower calcification levels (measured by von Kossa staining)

Notably, these protective effects were only observed in mice fed a Western diet (high-fat/high-cholesterol), not those on normal chow. This diet-dependent effect suggests CerS5 acts as an important mediator of inflammatory and calcification processes specifically in lipid-rich environments .

In cardiomyocytes, CerS5 regulates lipid-induced autophagy and hypertrophy. Experiments using siRNA-mediated CerS5 knockdown have demonstrated that CerS5 is required for myristate-induced cardiomyocyte hypertrophy. Furthermore, CerS5 regulates autophagy by controlling BECN1 expression levels, with overexpression of CerS5 inducing BECN1 expression even without myristate treatment .

How is CerS5 implicated in cancer progression and patient outcomes?

Analysis of colorectal cancer tissues has revealed striking associations between CerS5 expression and patient prognosis. Strong membranous CerS5 staining was observed in 56% (57/102) of colorectal cancer samples. Multivariate Cox regression analysis adjusting for disease stage, differentiation, and lymphovascular invasion demonstrated that high CerS5 expression correlates with:

Advanced proteomic analysis using reverse phase protein arrays from laser capture microdissection-enriched carcinoma cells identified two distinct signaling networks associated with CerS5 expression levels:

  • Weak membranous CerS5 intensity correlated with apoptosis-related signaling proteins

  • Strong CerS5 intensity associated with autophagy-related proteins

These findings suggest CerS5 may influence cancer progression by shifting cellular homeostasis from apoptotic to autophagic pathways, potentially explaining the poorer outcomes in patients with high CerS5 expression.

What approaches are effective for studying CerS5 function in mouse models?

Several effective approaches have been developed for investigating CerS5 function in vivo:

Genetic Models:

  • CerS5 knockout mice (CerS5-/-) provide a powerful platform for studying tissue-specific functions

  • Wire injury models combined with high-fat/high-cholesterol (Western) diet allow investigation of CerS5's role in cardiovascular pathologies

Tissue-Specific Analysis:

  • Comparative analysis of sphingolipid profiles across multiple tissues (lung, spleen, muscle, liver, white adipose tissue) using liquid chromatography-mass spectrometry enables comprehensive assessment of CerS5-dependent ceramide pools

  • Histological examination combined with specific staining (e.g., CD68 for immune cell infiltration, von Kossa for calcification) allows functional assessment in disease models

Functional Assessment:

  • Peak velocity measurements for evaluating aortic valve stenosis development

  • Glucose tolerance and insulin sensitivity testing in metabolic studies

  • Electroretinography for assessing retinal function after CerS5 manipulation

These approaches should be selected based on the specific research question and tissue of interest, as CerS5 demonstrates clear tissue-specific functions.

What are effective delivery methods for recombinant CerS5 in experimental models?

Recombinant adeno-associated viral vectors (rAAVs) have proven effective for delivering functional CerS5. Specifically, rAAV8-CerS5 has been successfully used in retinal studies, with documented dosage-dependent effects:

  • Medium dosage (7.5×10^11 gc/ml): Significantly improved scotopic and photopic b-wave amplitudes, with particularly strong functional recovery of cone cells

  • Low dosage (7.5×10^10 gc/ml): No significant impact on retinal function

  • High dosage (7.5×10^12 gc/ml): Detrimental impact on retinal functions

This dosage-dependent response curve highlights the importance of careful titration when using recombinant CerS5 delivery systems. The medium dosage provided optimal functional rescue in retinal models, suggesting this approach may be adaptable to other tissue systems while requiring tissue-specific optimization.

How can researchers distinguish between effects mediated by CerS5 versus other ceramide synthases?

Distinguishing CerS5-specific effects from those of other ceramide synthases requires a multi-faceted approach:

  • Acyl Chain Profiling: CerS5 primarily synthesizes C16:0 ceramides, so researchers should perform comprehensive sphingolipid profiling to identify specific changes in C16:0 ceramide levels. While CerS6 also produces C16:0 ceramides, tissue-specific expression patterns (e.g., low CerS6 expression in heart) can help discriminate between them .

  • Genetic Models: Comparing CerS5-/- mice with other CerS knockout models allows for identification of non-redundant functions. For example, CerS5 deficiency primarily affects C16:0 sphingolipid pools in specific tissues while glycerophospholipid levels remain unaltered .

  • Compensation Analysis: Researchers should assess potential compensatory mechanisms by other CerS enzymes in CerS5-deficient models. For instance, CerS5 dimerizes with CerS2 and enhances CerS2 activity, suggesting functional interactions between family members that may confound interpretation .

  • siRNA Knockdown Validation: Using targeted siRNA-mediated knockdown of CerS5 in cellular models can confirm specific functional effects, as demonstrated in cardiomyocyte studies where CerS5 knockdown prevented lipid-induced hypertrophy and autophagy induction .

What factors should be considered when interpreting ceramide profile changes in CerS5 knockout models?

When interpreting ceramide profile changes in CerS5 knockout models, researchers should consider:

How do ceramide species produced by CerS5 influence distinct cellular processes?

The C16:0 ceramides predominantly produced by CerS5 exhibit specific effects on cellular processes that differ from those of other ceramide species:

Autophagy Regulation:
CerS5-derived ceramides play a crucial role in regulating autophagy, particularly in cardiomyocytes. CerS5 overexpression induces BECN1 (Beclin 1) expression, a key autophagy regulator, while CerS5 knockdown reduces both basal and sphingolipid-induced BECN1 expression. This demonstrates a direct mechanistic link between CerS5 activity and autophagy machinery .

Cell Death Pathways:
Proteomic analysis of colorectal cancer tissues revealed that CerS5 expression levels correlate with distinct signaling networks. Low CerS5 expression associates with apoptosis-related signaling proteins, while high expression correlates with autophagy-related proteins. This suggests CerS5-derived ceramides may act as molecular switches between different cell death pathways .

Inflammation:
In aortic valve disease models, CerS5 deficiency reduces immune cell infiltration and calcification, but only under high-fat diet conditions. This suggests CerS5-derived ceramides specifically mediate diet-induced inflammatory responses rather than baseline inflammation .

Tissue Function:
In retinal models, CerS5 overexpression can compensate for ceramide deficiencies, with particular effectiveness in cone cell function recovery. This indicates CerS5-derived ceramides have specific roles in maintaining photoreceptor function that other ceramide species cannot fully replace .

What experimental approaches show promise for targeting CerS5 therapeutically?

Several experimental approaches demonstrate potential for therapeutic targeting of CerS5:

Gene Therapy:
Recombinant adeno-associated viral vectors (rAAVs) delivering CerS5 have shown promising results in retinal disease models. The rAAV8-CerS5 system demonstrated dose-dependent efficacy in restoring retinal function, particularly in cone cells, highlighting the potential for gene therapy approaches in tissues with ceramide deficiencies .

Small Molecule Inhibitors:
While not directly addressed in the provided search results, the enzymatic nature of CerS5 makes it amenable to small molecule inhibition. The critical importance of specific amino acids near the TLC domain for CerS5 enzymatic activity provides structural targets for inhibitor development .

Anti-inflammatory Applications:
CerS5 knockout mice showed reduced inflammation and calcification in aortic valve stenosis models when fed a Western diet, suggesting CerS5 inhibition could have therapeutic value in inflammatory cardiovascular diseases .

Cancer Treatment:
The strong association between high CerS5 expression and poor outcomes in colorectal cancer suggests CerS5 inhibition might offer therapeutic benefits in certain cancers. The shift from apoptotic to autophagic signaling networks associated with CerS5 expression provides a mechanistic rationale for this approach .

The therapeutic potential of CerS5 targeting appears most promising in metabolic disorders, cardiovascular diseases, retinal pathologies, and certain cancers, with the specific approach needing to be tailored to the tissue and condition being treated.

What are the key experimental controls needed when working with recombinant CerS5?

Researchers working with recombinant CerS5 should implement several critical controls:

Enzymatic Activity Validation:

  • Measure sphingolipid profiles to confirm increased C16:0 ceramide production

  • Include enzymatically inactive CerS5 mutants (e.g., mutations in the two positively charged amino acids upstream of the TLC domain that are required for activity)

Expression Level Controls:

  • Use dose-response studies to identify optimal expression levels, as both insufficient and excessive CerS5 expression can produce misleading results

  • Include Western blot or other protein quantification methods to confirm expression levels

Specificity Controls:

  • Compare with other CerS family members, particularly CerS6 which also produces C16:0 ceramides

  • Include sphingoid base treatments (e.g., dihydrosphingosine) with and without CerS5 to confirm pathway specificity

Functional Readouts:

  • Include appropriate functional assays relevant to the tissue being studied (e.g., ERG for retina, peak velocity for cardiovascular studies)

  • Measure both direct (ceramide levels) and indirect (downstream pathway activation) outcomes

These controls help ensure that observed effects are specifically attributable to CerS5 activity rather than experimental artifacts or compensatory mechanisms.

What methodological approaches are most suitable for measuring CerS5 enzymatic activity?

Several methodological approaches have proven effective for measuring CerS5 enzymatic activity:

Lipidomic Analysis:

  • Liquid chromatography-mass spectrometry (LC-MS) to quantify specific ceramide species, particularly C16:0 ceramides

  • Comparative analysis across multiple sphingolipid species to assess specificity

In Vitro Enzymatic Assays:

  • Cell-free systems using recombinant CerS5 with acyl-CoA substrates and sphingoid bases

  • Radioactive or fluorescent-labeled substrates for quantitative measurement of product formation

Cellular Assays:

  • siRNA knockdown of CerS5 followed by sphingolipid profiling to assess contribution to baseline ceramide levels

  • Overexpression systems with sphingoid base treatments to measure ceramide production capacity

Pathway Analysis:

  • Measurement of downstream effects such as BECN1 expression levels, which respond directly to CerS5 activity

  • Analysis of specific signaling networks associated with CerS5-derived ceramides

These approaches should be selected based on the specific research question, with comprehensive sphingolipid profiling being generally essential for any CerS5-focused study.

What are the emerging areas of CerS5 research with therapeutic potential?

Several promising research directions for CerS5 are emerging with therapeutic potential:

Metabolic Disorders:
Further investigation of CerS5's role in obesity and insulin resistance could yield targeted therapies for metabolic syndrome. The tissue-specific effects of CerS5 deficiency suggest potential for selective intervention in metabolic tissues .

Cardiovascular Disease:
CerS5's role in aortic valve stenosis development, particularly in diet-induced models, positions it as an interesting target for pharmacological therapy. Its involvement in both inflammation and calcification processes suggests broad cardiovascular applications .

Retinal Degeneration:
The successful application of rAAV8-CerS5 in restoring retinal function in mouse models highlights potential gene therapy approaches for inherited retinal dystrophies involving ceramide imbalances .

Cancer Therapy:
The strong correlation between high CerS5 expression and poor outcomes in colorectal cancer, coupled with its association with autophagy-related signaling, suggests potential for targeting CerS5 in cancer treatment strategies .

Inflammation Modulation:
The anti-inflammatory effects observed in CerS5-deficient mice on Western diet warrant further investigation into CerS5 inhibition as an anti-inflammatory strategy, particularly in diet-related inflammatory conditions .

What technological advances would facilitate deeper understanding of CerS5 biology?

Several technological advances would significantly advance CerS5 research:

Tissue-Specific Conditional Knockouts:
Development of inducible, tissue-specific CerS5 knockout models would allow for more precise delineation of its functions across different tissues while avoiding developmental compensation.

Selective Inhibitors:
Creation of highly selective small molecule inhibitors of CerS5 that don't affect other CerS family members would provide valuable tools for both research and potential therapeutic applications.

Advanced Imaging Techniques:
Implementation of techniques to visualize ceramide dynamics in living cells and tissues would enhance understanding of how CerS5-derived ceramides influence membrane organization and signaling.

Single-Cell Analysis:
Application of single-cell transcriptomics and proteomics to CerS5-expressing tissues would reveal cell-specific functions and heterogeneity that might be missed in bulk tissue analysis.

Systems Biology Approaches: Integration of lipidomics, proteomics, and transcriptomics data would provide comprehensive understanding of how CerS5-derived ceramides influence broader cellular networks across different physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.