Recombinant Mouse Ceramide synthase 6 (Cers6)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

Cers6 belongs to the ceramide synthase family (CerS1–6), each with distinct fatty acyl-CoA preferences. Key characteristics include:

PropertyDetailsSources
Preferred acyl chainC16:0 (palmitoyl-CoA)
Subcellular localizationEndoplasmic reticulum, plasma membrane
Sphingolipid productsC16:0 ceramide, dihydroceramide, and hexosylceramide

Cers6 competes with CerS5 (another C16:0 ceramide producer) but exhibits unique tissue-specific expression patterns, particularly in immune cells and hypothalamic neurons .

Hypothalamic Regulation of Obesity

Cers6-derived C16:0 ceramides in pro-opiomelanocortin (POMC) and steroidogenic factor 1 (SF-1) neurons drive mitochondrial fragmentation, ER stress, and leptin resistance during high-fat diet (HFD) feeding :

ConditionEffect of Cers6 Knockout
HFD-induced obesityReduced weight gain, improved glucose tolerance, and restored mitochondrial dynamics
Palmitate exposureAttenuated ER/mitochondrial stress and improved leptin sensitivity

Neuron-specific Cers6 deletion mitigates HFD-induced metabolic dysfunction, highlighting its role in central energy balance regulation .

Colitis and Immune Function

Adoptive transfer of Cers6-deficient splenocytes reduces colitis severity in mice, likely due to altered immune cell migration/proliferation rather than T-cell polarization .

Cancer Chemoresistance

Cers6 overexpression in T-cell acute lymphoblastic leukemia (T-ALL) correlates with resistance to ABT-737 (a BCL-2 inhibitor) by disrupting Fas–FADD DISC assembly and extrinsic apoptosis .

Alcoholic Steatosis

Cers6 upregulation in liver lipid droplets promotes perilipin-2 (PLIN2) expression and hepatic steatosis in alcohol-fed mice and humans .

Genetic Models

  • Cers6 ADAAAIA mice: Reduced C16:0 ceramide levels without affecting enzyme expression, suggesting post-translational regulatory roles .

  • Neuron-specific knockouts: Improved insulin sensitivity and mitochondrial function in obesity models .

Unresolved Questions

  • Recombinant Cers6 applications: No direct studies on recombinant mouse Cers6 purification or in vitro characterization were identified. Current insights derive from endogenous enzyme analyses or overexpression systems .

  • Compensatory ceramide species: Mechanisms enabling survival in Cers6/CerS5 double-deficient mice remain unclear .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Cers6; Lass6; Ceramide synthase 6; CerS6; LAG1 longevity assurance homolog 6; Sphingoid base N-palmitoyltransferase CERS6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cers6
Target Protein Sequence
MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFIA KPCAIALNIQANGPQTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR RNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPLTADLHY YYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLVLCLHDS ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS WWVFNLLLLLLQGLNCFWSYLIVKIACKTVSKGKVSKDDRSDIESSSDDEDSEPPGKKPH SSTTTNGTSGTNGYLLTGPCSVDD
Uniprot No.

Target Background

Function
Ceramide synthase 6 (CERS6) is an enzyme that catalyzes the transfer of an acyl chain from acyl-CoA to a sphingoid base, exhibiting high selectivity for palmitoyl-CoA (hexadecanoyl-CoA; C16:0-CoA). While it can utilize other acyl donors, their efficiency is lower. CERS6 N-acylates sphinganine and sphingosine bases to form dihydroceramides and ceramides, respectively, in de novo synthesis and salvage pathways. Ceramides generated by CERS6 play a role in the inflammatory response. It acts as a regulator of metabolism and hepatic lipid accumulation. Under a high-fat diet, palmitoyl- (C16:0-) ceramides produced by CERS6 specifically bind to the mitochondrial fission factor MFF, promoting mitochondrial fragmentation and contributing to the development of obesity.
Gene References Into Functions
  1. Ceramide synthase (CerS)6 was specifically up-regulated in experimental alcoholic steatosis in vivo and in vitro. PMID: 28864659
  2. Deletion of CerS6 increases energy expenditure and improves glucose tolerance, not only in CerS6(Delta/Delta) mice but also in brown adipose tissue- (CerS6(DeltaBAT)) and liver-specific (CerS6(DeltaLIVER)) CerS6 knockout mice. PMID: 25295788
  3. Research indicates that ceramide synthase 6 knockout (CerS6KO) experimental autoimmune encephalomyelitis (EAE) mice exhibit exacerbated progression of clinical symptoms. PMID: 25833068
  4. CerS6 protein is N-glycosylated and expressed in various tissues of mice, primarily the kidney, small and large intestine, and brain. PMID: 23760501
  5. A significant role has been identified for C16:0-Cer (ceramide synthase 6) in the inflammatory process and subsequent induction of experimental autoimmune encephalitis. PMID: 22544924

Show More

Hide All

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Broadly expressed, with highest levels in kidney and brain (at protein level).

Q&A

What is ceramide synthase 6 and what is its role in sphingolipid metabolism?

Ceramide synthase 6 (CerS6) is one of six mammalian ceramide synthase isoforms (CerS1-6) that catalyze the N-acylation of (dihydro-)sphingosine to produce (dihydro-)ceramide. CerS6 specifically incorporates C16:0 acyl chains into ceramides, showing strong substrate specificity for C16:0-acyl-CoA . The enzyme is a multi-spanning membrane protein located in the endoplasmic reticulum (ER) and belongs to the larger Tram-Lag-CLN8 (TLC) domain family . CerS6-generated ceramides serve as crucial membrane lipids and signaling molecules involved in various cellular processes including stress responses and apoptosis .

Methodologically, researchers investigating CerS6's role in sphingolipid metabolism should employ lipidomic analyses using quadrupole time-of-flight mass spectrometry (MS) to comprehensively profile changes in sphingolipid species. This approach allows for precise quantification of C16:0-ceramide and dihydroceramide levels in various tissues, providing insights into CerS6's tissue-specific functions .

How is CerS6 expression distributed across mouse tissues?

CerS6 exhibits a tissue-specific expression pattern in mice. Using CerS6-specific antibodies, researchers have identified high CerS6 expression levels in the kidney, particularly in podocytes . The protein is also expressed in brain tissues, which correlates with behavioral phenotypes observed in CerS6-deficient mice . Western blotting analysis shows variable expression across tissues, with particularly high levels detected in the kidney .

For researchers studying tissue distribution, it is recommended to use custom-designed primary antibodies against CerS6 (at 1:100 dilution for immunoblotting) followed by detection with HRP-conjugated secondary antibodies and chemiluminescence visualization . Tissue-specific expression patterns should be verified using both immunoblotting and immunohistochemical approaches to confirm cellular localization.

What distinguishes CerS6 from other ceramide synthase family members?

CerS6 is distinguished from other ceramide synthase family members by several key features:

  • Substrate specificity: CerS6 predominantly uses C16:0-acyl-CoA substrates for ceramide synthesis, whereas other CerS isoforms prefer different acyl chain lengths .

  • C-terminal motif: CerS6 contains a distinctive DDRSDIE motif at its C-terminus, which is characteristic of ceramide synthases but not other TLC family members. This motif is involved in CerS dimer formation .

  • Glycosylation pattern: CerS6 undergoes glycosylation at specific sites, particularly at Asn18, which is critical for its enzymatic activity .

  • Tissue distribution: CerS6 shows a unique tissue expression pattern compared to other CerS isoforms, with prominent expression in kidney podocytes .

For experimental differentiation between CerS isoforms, researchers should conduct substrate specificity assays using different acyl-CoA chain lengths and perform co-immunoprecipitation studies to analyze interaction patterns between different ceramide synthases.

What is the significance of the DDRSDIE motif in CerS6?

The DDRSDIE motif is a short C-terminal sequence in CerS6 that distinguishes ceramide synthases from other members of the TLC domain family. Research indicates this motif is involved in CerS dimer formation, as determined by co-immunoprecipitation studies . When this motif is deleted or modified, the ability of CerS to form homo- or heterodimers is affected, although interestingly, the in vitro catalytic activity remains intact .

To investigate this motif experimentally, researchers have employed CRISPR-Cas9 gene editing to replace the DDRSDIE sequence with ADAAAIA in mice. While these modified mice showed normal CerS6 protein expression levels and retained the ability to synthesize C16-ceramide in vitro, they unexpectedly demonstrated reduced ceramide levels in vivo . This suggests the motif may be involved in an unknown regulatory mechanism for ceramide synthesis that is only apparent in the intact organism.

Methodologically, researchers studying this motif should combine protein interaction studies (co-immunoprecipitation, FRET) with enzymatic activity assays and in vivo lipidomic analyses to fully understand its functional significance.

How does glycosylation affect CerS6 activity?

Glycosylation plays a critical role in regulating CerS6 enzymatic activity. Research has identified that basal glycosylation of CerS6 at asparagine-18 (Asn18) is specifically required for its catalytic function . Studies using CRISPR-Cas9 CerS6 knockout cells with reintroduction of either wild-type CerS6 or a mutant CerS6 with a point mutation at Asn18 (N18A) have demonstrated that the loss of glycosylation at this site significantly reduces enzymatic activity .

Additionally, researchers have observed that certain ER stress inducers like brefeldin A (BFA) cause increased glycosylation of CerS6, though this stress-induced hyperglycosylation does not appear to affect CerS6 activity beyond the requirement for basal glycosylation .

For experimental investigation of CerS6 glycosylation, researchers should employ deglycosylation assays using N-glycosidase F treatment of purified CerS6 protein (20 μg is recommended) followed by activity measurements . Site-directed mutagenesis of potential glycosylation sites coupled with functional assays provides a robust approach to determine the specific contribution of individual glycosylation events to enzyme activity.

What techniques are most effective for measuring CerS6 enzymatic activity?

Several complementary approaches are recommended for robust measurement of CerS6 enzymatic activity:

  • In vitro CerS assays: Using tissue homogenates or cell lysates, researchers can measure the incorporation of radiolabeled or fluorescently labeled (e.g., NBD-sphinganine) acyl-CoA substrates into ceramide. This provides a direct assessment of enzymatic activity under controlled conditions .

  • Metabolic labeling: For cellular studies, metabolic labeling with NBD-sphinganine allows tracking of ceramide synthesis in intact cells, providing insights into the activity of CerS6 in a cellular context .

  • Mass spectrometry analysis: Quantitative lipidomic profiling using quadrupole time-of-flight mass spectrometry enables precise measurement of C16:0-ceramide and C16:0-dihydroceramide levels in tissues or cells, reflecting the cumulative activity of CerS6 in vivo .

  • Activity correlation with glycosylation state: For complete characterization, researchers should analyze CerS6 glycosylation status in parallel with activity measurements, particularly when studying conditions that might affect post-translational modifications .

When interpreting activity data, researchers should be aware that in vitro activity doesn't always correlate with in vivo ceramide levels, as demonstrated in the CerS6 ADAAAIA mouse model, suggesting complex regulatory mechanisms beyond intrinsic enzymatic capacity .

What genetic approaches have been used to generate CerS6-modified mice?

Several genetic approaches have been successfully employed to generate CerS6-modified mice:

  • Complete knockout (CerS6KO): Researchers have generated mice expressing enzymatically inactive CerS6 protein by targeting critical regions of the gene. This approach typically involves homologous recombination strategies with a targeting vector containing selection markers like neomycin resistance . Southern blot analysis with both external and internal probes (e.g., 541-bp fragment using specific primers for the external probe) can verify correct targeting .

  • CRISPR-Cas9 gene editing: More recently, CRISPR-Cas9 has been used to create specific modifications in the CerS6 gene, such as replacing the DDRSDIE motif with ADAAAIA. This approach allows for precise editing without requiring selection markers to remain in the genome . Successful editing can be verified by PCR amplification and sequencing of the modified region.

  • Conditional knockouts: Though not explicitly mentioned in the provided sources, conditional knockout approaches using Cre-loxP systems would be valuable for studying tissue-specific roles of CerS6.

For all genetic modifications, researchers should perform comprehensive validation including:

  • Genotyping PCR (with appropriate primers yielding distinct band sizes for wild-type and modified alleles)

  • Western blotting to confirm protein expression levels

  • In vitro enzyme activity assays

  • Lipidomic profiling to assess impact on sphingolipid levels

What phenotypes are observed in CerS6-deficient mice?

CerS6-deficient mice display several distinct phenotypes that provide insights into the physiological roles of CerS6:

  • Behavioral abnormalities: CerS6KO mice exhibit explorative abnormalities in novel environments, including behavioral habituation deficits . This suggests a role for CerS6-generated ceramides in neurological function.

  • Motor phenotypes: A clasping phenotype of the hind limbs has been observed in CerS6KO mice, indicating potential neuromotor dysfunction .

  • Sphingolipid alterations: As expected, CerS6-deficient mice show decreased levels of C16:0-containing sphingolipids in most tissues examined, confirming the specific role of CerS6 in generating these lipid species . The extent of reduction varies by tissue, reflecting the tissue-specific expression and importance of CerS6.

  • Compensatory mechanisms: When CerS6 is inactivated, elevations in very-long chain ceramide and dihydroceramide levels are often observed, suggesting compensatory upregulation of other CerS isoforms .

For comprehensive phenotypic analysis, researchers should employ a battery of behavioral tests to assess neurological function, coupled with detailed lipidomic profiling across multiple tissues. Importantly, researchers should maintain mice on a standardized genetic background (preferably C57BL/6, backcrossed for at least 8 generations) and house them under standard conditions with a 12-hour light/dark cycle and ad libitum access to food and water .

How does simultaneous modification of CerS5 and CerS6 affect sphingolipid metabolism?

The combined modification of CerS5 and CerS6 has dramatic effects on sphingolipid metabolism, particularly on C16:0-ceramide levels. Research crossing CerS6 ADAAAIA mice (with the modified DDRSDIE motif) with CerS5 null mice has revealed:

This experimental model provides an excellent tool for investigating the specific biological roles of C16:0-ceramide. Researchers studying combined CerS5/CerS6 modifications should employ comprehensive lipidomic profiling of multiple tissues, assess potential developmental abnormalities, and conduct functional studies to determine the physiological consequences of drastically reduced C16:0-ceramide levels.

What techniques are recommended for detecting and quantifying CerS6 protein?

Several complementary techniques are recommended for robust detection and quantification of CerS6 protein:

  • Western blotting: Custom-designed primary antibodies against CerS6 (used at 1:100 dilution) followed by HRP-conjugated secondary antibodies (1:10,000) provide specific detection . Proteins should be separated on 10% SDS-PAGE gels and transferred to nitrocellulose membranes at 100V for 1 hour. For optimal results, block membranes in TBS-T containing 5% milk powder overnight at 4°C before antibody incubation .

  • Deglycosylation analysis: Since CerS6 is glycosylated, treatment with N-glycosidase F (following manufacturer's instructions for 20 μg of glycoprotein) can help distinguish between glycosylated and unglycosylated forms, providing insights into post-translational processing .

  • Immunohistochemistry: For tissue localization studies, immunohistochemical staining can reveal the cell-specific expression pattern of CerS6, such as its localization in kidney podocytes .

  • Quantitative PCR: While not directly measuring protein, qPCR analysis of CerS6 mRNA expression provides valuable complementary data, especially when correlated with protein levels.

For validation of antibody specificity, researchers should include appropriate controls such as tissues from CerS6 knockout mice. When analyzing CerS6 protein levels in experimental contexts, normalization to housekeeping proteins like GAPDH is essential for accurate quantification .

How can researchers effectively analyze sphingolipid changes in CerS6-modified models?

Comprehensive analysis of sphingolipid changes in CerS6-modified models requires a multi-faceted approach:

  • Lipidomic mass spectrometry: Quadrupole time-of-flight mass spectrometry (MS) is the gold standard for comprehensive sphingolipid profiling, allowing precise quantification of ceramides with different acyl chain lengths as well as complex sphingolipids . This approach can detect subtle changes in C16:0-ceramide and C16:0-dihydroceramide levels across different tissues.

  • Tissue-specific analysis: Given the variable expression of CerS6 across tissues, researchers should analyze multiple tissue types including kidney, brain, liver, and small intestine, where CerS6 functions have been documented .

  • Comparative profiling: Analysis should include not only ceramides but also derivatives such as sphingomyelins, glycosphingolipids, and sphingosine/sphingosine-1-phosphate to understand the broader impact on sphingolipid metabolism .

  • Correlation with phenotypes: Sphingolipid changes should be correlated with observed phenotypes to establish potential causal relationships between specific lipid alterations and functional outcomes.

  • Time-course studies: When feasible, time-course analyses can reveal dynamic changes in sphingolipid metabolism and potential compensatory mechanisms that develop over time in CerS6-modified models.

For interpretation, researchers should be aware that reductions in one ceramide species often lead to compensatory increases in ceramides with different acyl chain lengths, as frequently observed in CerS knockout models .

What in vitro systems are most appropriate for studying CerS6 function?

Several in vitro systems offer complementary approaches for investigating CerS6 function:

  • Tissue homogenates: Homogenates from various tissues of wild-type and CerS6-modified mice provide a direct way to compare enzymatic activity in a near-native environment . This approach is particularly valuable for comparing tissues with different expression levels of CerS5 and CerS6.

  • CRISPR-Cas9 engineered cell lines: HCT116 cells with CRISPR-Cas9-mediated CerS6 knockout, complemented with reintroduction of either wild-type or mutant CerS6, offer a robust system for structure-function studies . This approach is particularly valuable for investigating specific modifications such as glycosylation site mutations.

  • Recombinant expression systems: For biochemical characterization, recombinant expression of CerS6 in appropriate host cells allows purification and detailed enzymatic analysis. Care must be taken to ensure proper membrane insertion and post-translational modifications.

  • Primary cell cultures: When studying tissue-specific functions, primary cell cultures from relevant tissues (e.g., kidney podocytes, neurons) of wild-type and CerS6-modified mice can provide insights into cell-autonomous effects of CerS6 alterations.

For activity assays in these systems, researchers should use appropriate acyl-CoA substrates (particularly C16:0-acyl-CoA) and either radiolabeled or fluorescently labeled sphingoid bases. Control experiments should include specific inhibitors of ceramide synthases to confirm the specificity of observed activity .

How does CerS6 contribute to cellular stress responses?

CerS6 plays significant roles in cellular stress response pathways, particularly in ER stress:

  • Stress-induced modifications: Under ER stress conditions induced by agents like brefeldin A (BFA), CerS6 undergoes increased glycosylation . This modification appears to be specifically related to stress conditions rather than normal physiological regulation.

  • Ceramide accumulation during stress: BFA treatment leads to increased endogenous ceramide accumulation, suggesting a potential role for CerS6 in stress-responsive ceramide production . This ceramide elevation may contribute to stress signaling cascades.

  • Regulatory mechanisms: The stress-induced glycosylation of CerS6 does not directly affect its enzymatic activity, suggesting that other regulatory mechanisms must exist to explain the increased ceramide levels during stress .

For researchers investigating CerS6 in stress responses, recommended approaches include:

  • Monitoring changes in CerS6 post-translational modifications in response to various stressors

  • Correlating these changes with alterations in sphingolipid metabolism using lipidomic analysis

  • Examining the impact of CerS6 deficiency on stress response pathways

  • Investigating potential protein-protein interactions that may regulate CerS6 function during stress

Understanding the interplay between CerS6, ER stress, and ceramide signaling could provide valuable insights into cellular adaptation to stress conditions and potential therapeutic interventions in stress-related pathologies.

What is the relationship between CerS6 activity and behavioral phenotypes?

The relationship between CerS6 activity and behavioral phenotypes represents an intriguing frontier in sphingolipid research:

  • Explorative abnormalities: CerS6KO mice exhibit altered exploratory behavior in novel environments, including deficits in behavioral habituation . This suggests a role for CerS6-generated ceramides in neural circuits governing environmental adaptation and learning.

  • Motor coordination: The observed clasping phenotype of hind limbs in CerS6KO mice indicates potential neuromotor dysfunction , suggesting involvement of CerS6 in neural circuits governing motor control.

  • Mechanistic hypotheses: Several mechanisms could explain these behavioral phenotypes:

    • Altered membrane properties affecting neuronal signaling

    • Disruption of lipid rafts important for neurotransmitter receptor localization

    • Changes in sphingolipid-dependent signaling pathways in neurons

    • Developmental effects during neural circuit formation

For researchers studying the neurological aspects of CerS6 function, recommended approaches include:

  • Comprehensive behavioral testing batteries beyond basic exploration tests

  • Electrophysiological studies of neuronal function in CerS6-deficient models

  • Region-specific analyses of brain sphingolipid composition

  • Conditional knockout approaches targeting specific neural populations

  • Investigation of potential synaptic transmission defects

These approaches could help elucidate the precise mechanisms by which CerS6-generated ceramides influence neural function and behavior, potentially revealing new insights into sphingolipid roles in neurological disorders.

What are the implications of CerS6/CerS5 functional redundancy for experimental design?

The functional redundancy between CerS5 and CerS6 has significant implications for experimental design in sphingolipid research:

  • Compensatory mechanisms: When either CerS5 or CerS6 is inactivated, the other may partially compensate, potentially masking phenotypes . This is evidenced by the much more severe reduction in C16:0-ceramide levels in double-modified mice compared to single modifications.

  • Tissue-specific considerations: The relative importance of CerS5 versus CerS6 varies by tissue, with different expression patterns and contributions to C16:0-ceramide synthesis . This necessitates tissue-specific analyses rather than generalizing findings across all tissues.

  • Experimental strategies to address redundancy:

    • Use of double knockout/modified models: The CerS6 ADAAAIA/CerS5 null mouse model demonstrates the value of simultaneous targeting of both enzymes to reveal phenotypes that might be masked by compensation .

    • Conditional and inducible approaches: Acute inactivation may reveal phenotypes before compensatory mechanisms develop.

    • Careful quantification of both enzymes: Expression analysis of both CerS5 and CerS6 should accompany phenotypic studies.

    • Detailed lipidomic profiling: Analysis should examine not only C16:0-ceramide reduction but also compensatory increases in other ceramide species.

  • Mechanistic insights from redundancy: The viability of mice with ~90% reduction in C16:0-ceramide suggests either remarkable resilience to ceramide depletion or effective compensation by other sphingolipid species . This observation can inform fundamental questions about sphingolipid requirements in mammalian physiology.

Researchers designing experiments involving CerS6 should carefully consider these redundancy issues to avoid false-negative results and to fully understand the biological roles of C16:0-ceramide in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.