Recombinant Mouse Chemokine-binding protein 2 (Ccbp2)

Shipped with Ice Packs
In Stock

Description

Chemokine Interaction Profile

Ccbp2 exhibits broad chemokine-binding activity, modulating inflammation by controlling extracellular chemokine gradients. Key interactions include:

ChemokineBinding Affinity (Ki)Functional Impact
CCL210–100 nM Reduced scavenging efficiency in ACKR2-V41A variant linked to Alzheimer’s risk
CCL5≤300 nM Implicated in tumor microenvironment modulation in pancreatic cancer
CXCL12≤10 nM Competes with CXCR4; regulates leukocyte trafficking
CCL22Intermediate affinity Associated with Treg cell migration in autoimmune contexts

Inflammatory Regulation

  • Psoriasis Model: ACKR2-deficient mice develop severe skin inflammation resembling psoriasis due to impaired CCL2/CCL5 clearance .

  • Myocardial Infarction: ACKR2 scavenges CCL2 to reduce classical monocyte infiltration, improving cardiac repair .

  • Autoimmunity: ACKR2 deficiency enhances Th17 polarization but does not suppress autoreactive T-cell priming .

Cancer Biology

  • Colorectal Cancer: ACKR2 limits tumor-promoting inflammation by scavenging CCL3/CCL5 .

  • Pre-eclampsia: Upregulated placental ACKR2 correlates with impaired trophoblast invasion and inflammation .

Genetic Variants

  • V41A Polymorphism (rs2228467): Reduces CCL2 binding affinity by 50%, increasing cerebrospinal fluid CCL2 levels and Alzheimer’s disease risk .

Recombinant Applications

Recombinant mouse Ccbp2 is used to study chemokine dynamics in vitro and in vivo. Notable applications include:

ApplicationExperimental ModelOutcome
Chemokine Scavenging AssaysHEK293 cells + CAF supernatantReduced CXCL1/CCL2/CCL5 levels by 40–60%
Trophoblast Function StudiesHTR8/SVneo cellsACKR2 knockdown increased proliferation and migration by 30%
Inflammatory ResolutionZebrafish embryogenesisACKR3 (homolog) regulates CXCL12 gradients for developmental cell migration

Clinical and Therapeutic Implications

  • Biomarker Potential: Elevated ACKR2 in peripheral blood mononuclear cells (PBMCs) correlates with IL-6/HGF levels in chronic inflammation .

  • Therapeutic Target: Small-molecule ACKR2 agonists could enhance chemokine clearance in inflammatory diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please specify your requirement when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your use.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
Ackr2; Ccbp2; D6; Atypical chemokine receptor 2; C-C chemokine receptor D6; Chemokine-binding protein 2; Chemokine-binding protein D6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPTVASPLPLTTVGSENSSSIYDYDYLDDMTILVCRKDEVLSFGRVFLPVVYSLIFVLGL AGNLLLLVVLLHSAPRRRTMELYLLNLAVSNLLFVVTMPFWAISVAWHWVFGSFLCKVIS TLYSINFYCGIFFITCMSLDKYLEIVHAQPLHRPKAQFRNLLLIVMVWITSLAISVPEMV FVQIHQTLDGVWHCYADFGGHATIWKLYLRFQLNLLGFLLPLLAMIFFYSRIGCVLVRLR PPGQGRALRMAAALVIVFFMLWFPYNLTLFLHSLLDLHVFGNCEISHRLDYTLQVTESLA FSHCCFTPVLYAFCSHRFRRYLKAFLSVMLRWHQAPGTPSSNHSESSRVTAQEDVVSMND LGERQSEDSLNKGEMGNT
Uniprot No.

Target Background

Function
Chemokine-binding protein 2 (Ccbp2), also known as atypical chemokine receptor 2 (ACKR2), is a unique chemokine receptor that regulates chemokine levels and localization. It achieves this by binding chemokines with high affinity, but unlike conventional receptors, it does not initiate typical ligand-driven signal transduction. Instead, it leads to chemokine sequestration, degradation, or transcytosis. ACKR2, also referred to as an interceptor, chemokine-scavenging receptor, or chemokine decoy receptor, interacts with a variety of chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES, and SCYA7/MCP-3. Upon ligand stimulation, ACKR2 activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway. This pathway results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling cascade. This activation leads to the upregulation of ACKR2 from the endosomal compartment to the cell membrane, enhancing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in the placenta, ACKR2 plays a crucial role in resolving (terminating) the inflammatory response and regulating adaptive immune responses. It is particularly important in the immune silencing of macrophages during inflammation resolution. ACKR2 also acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is essential for LECs to distinguish between immature and mature dendritic cells.
Gene References Into Functions
  1. ACKR2 (Ccbp2) is a key regulator of myeloid differentiation and function, and targeting it unleashes the anti-metastatic activity of neutrophils. PMID: 29445158
  2. ACKR2 is induced after traumatic brain injuries and has a significant impact on mortality and lesion development acutely following closed head injury. PMID: 29176798
  3. ACKR2 is an important regulator of branching morphogenesis in diverse biological contexts; this provides the first evidence of a role for chemokines and their receptors in postnatal developmental processes. PMID: 27888192
  4. Ackr2 expression levels limit the development of cutaneous inflammatory responses in psoriasis. PMID: 27568525
  5. ACKR2 deletion reduced renal inflammation in diabetes and ultimately provided a high degree of protection from diabetic nephropathy. PMID: 26798651
  6. Ackr2 deficiency does not suppress autoreactive T-cell priming and autoimmune pathology but can enhance T-cell polarization toward Th17 cells. PMID: 25348934
  7. ACKR2 can regulate fetal growth, placental structure, and neonatal mortality in mice. PMID: 25297873
  8. Further examination revealed that the proximity of pro-lymphangiogenic macrophages to developing lymphatic vessel surfaces is increased in ACKR2-deficient mice and reduced in CCR2-deficient mice. PMID: 25271254
  9. Certain cells, including plasmacytoid dendritic cells, can express both CCR2 and ACKR2; Ly6C(high) monocytes have particularly strong CCL2-scavenging potential in vitro and in vivo; and CCR2 is a much more effective CCL2 scavenger than ACKR2. PMID: 24890717
  10. Expression of the D6 receptor mediates dendritic cell function and promotes corneal allograft rejection. PMID: 24357920
  11. Our data indicate that D6 can play a cell-autonomous role as a migratory rheostat restricting migration of D6-expressing cells such as neutrophils. PMID: 23670187
  12. These data demonstrate a novel role for D6 as a regulator of the transition from uninvolved to lesional skin in psoriasis. PMID: 22867710
  13. Results indicate a novel mode of action for D6 during the resolution of inflammation that is instrumental in shaping resolving macrophage phenotypes and completing resolution. PMID: 22651933
  14. Chemokine decoy receptor D6 limits CC-chemokine-dependent pathogenic inflammation and is required for adequate cardiac remodeling after myocardial infarction. PMID: 22796582
  15. Control of CCR2 ligands by D6 regulates the traffic of Ly6C(high) monocytes and controls their immunosuppressive potential. PMID: 22504926
  16. D6, by suppressing inflammatory chemokine binding to lymphatic surfaces and thereby preventing inflammatory leukocyte adherence, is a regulator of lymphatic function and a contributor to the integration of innate and adaptive immune responses. PMID: 21979941
  17. We identify novel D6(active) B1-cell subsets, including those we term B1d, which lack CD5 and CD11b but exhibit typical B1-cell properties, including spontaneous ex vivo production of IgM, IL-10, and anti-phosphorylcholine antibody. PMID: 21450903
  18. Fetal D6 suppresses inflammation in many mouse tissues, and notably, D6-deficient fetuses in D6-deficient female mice show increased susceptibility to inflammation-driven resorption. PMID: 20147628
  19. The chemokine scavenger receptor D6 has a non-redundant role in acute toxic liver injury in vivo; results support the importance of post-translational chemokine regulation and describe a new mechanism of immune modulation within the liver. PMID: 19642876
  20. CCR10 engagement by locally produced CCL27 allows melanoma cells to escape host immune antitumor killing mechanisms (possibly through activation of PI3K/Akt), thereby providing a means for tumor progression. PMID: 14581607
  21. CCR9-deficient IgA+ plasma cells show reduced migration into the small intestine compared with wild-type controls. PMID: 14744993
  22. The chemokine receptor D6 limits the inflammatory response in vivo. PMID: 15750596
  23. The priming of encephalitogenic T cells is impaired in D6-deficient mice, supporting a role for D6 in aspects of immunity despite its nonsignaling capacity. PMID: 16785491
  24. We also propose that lymphatic endothelial cell-expressed D6 might have a distinct but complementary role in restricting inflammatory leukocyte access to the lymphatic vasculature. PMID: 16814608
  25. The ability of D6 to scavenge chemokines in the lung is dependent on chemokine concentration. The absence of D6 increases inflammation but reduces airway reactivity. PMID: 17095748
  26. Decoy receptor for inflammatory CC chemokines D6 plays a nonredundant role in the protection against fetal loss caused by systemic inflammation and antiphospholipid antibodies. PMID: 17283337
  27. We demonstrate the importance of proinflammatory CC chemokines in de novo tumorigenesis and reveal chemokine sequestration by D6 to be a novel and effective method of tumor suppression. PMID: 17607362
  28. The D6 decoy receptor plays a key role in setting the balance between antimicrobial resistance, immune activation, and inflammation in M. tuberculosis infection. PMID: 18695004
  29. D6 expression is GATA1 dependent. PMID: 18714007
  30. D6 can contribute to the development of colitis by regulating IL-17A secretion by gammadelta T cells in the inflamed colon. PMID: 19342683
  31. The results indicate that the induction of inflammatory chemokines after TB challenge includes D6 clearance of CC chemokines to contain the immune response and prevent excessive tissue damage. PMID: 19446728

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed on apoptotic neutrophils (at protein level).

Q&A

What is Recombinant Mouse Chemokine-binding Protein 2 (Ccbp2) and its biological significance?

Recombinant Mouse Chemokine-binding Protein 2 (Ccbp2), also known as ACKR2, belongs to the atypical chemokine receptor family. Unlike canonical chemokine receptors that signal through G-proteins, ACKR2 functions primarily as a scavenger receptor, modulating chemokine levels by internalizing and degrading them. This mechanism plays a critical role in maintaining inflammatory balance within tissues, particularly at sites of immune activation such as the maternal-fetal interface during pregnancy .

Ccbp2 has been implicated in various physiological and pathological processes, including immune regulation, inflammation suppression, and tissue remodeling. For instance, its expression in placental trophoblast cells highlights its role in mitigating immune overactivation at the maternal-fetal interface during pregnancy-related conditions like preeclampsia .

How is Ccbp2 expressed and purified in recombinant systems?

Recombinant Ccbp2 is typically expressed in bacterial systems such as Escherichia coli. The protein is engineered to include specific domains necessary for its function, such as glycosaminoglycan (GAG)-binding sites. Purification methods involve affinity chromatography techniques like His-tag purification, followed by validation using SDS-PAGE to ensure purity levels exceeding 95% .

For example, recombinant mouse Ccbp2 produced via E. coli expression systems includes residues Ala28-Asn100, with a molecular weight of approximately 7.9 kDa. Lyophilized formulations are stabilized with buffers containing Tris and NaCl at pH 8.0 . These formulations are stored at -20°C to -80°C for long-term stability.

What experimental models are commonly used to study Ccbp2?

Experimental models for studying Ccbp2 include:

  • Cell-based assays: These involve transfecting cell lines with siRNA targeting Ccbp2 to observe changes in proliferation, migration, and invasion behaviors .

  • Animal models: Mouse models are used to investigate the role of Ccbp2 in inflammation and disease pathogenesis.

  • Bioinformatics approaches: Weighted Gene Co-expression Network Analysis (WGCNA) has been employed to identify Ccbp2 as a hub gene associated with specific conditions such as preeclampsia .

What are the primary methods for detecting and quantifying Ccbp2?

Detection and quantification of recombinant Ccbp2 involve several techniques:

  • Western Blotting: Using specific antibodies against Ccbp2, researchers can assess protein expression levels in various tissues or cell lysates .

  • ELISA: Enzyme-linked immunosorbent assays provide quantitative measurements of Ccbp2 concentration in biological samples.

  • Mass Spectrometry: This technique offers high-resolution identification and quantification of post-translational modifications on recombinant proteins .

What are the known physiological roles of Ccbp2?

Ccbp2 regulates inflammatory responses by scavenging chemokines such as CXCL1 and CXCL8. This activity prevents excessive immune activation during inflammatory diseases, including glomerulonephritis and pulmonary inflammation . Additionally, its expression in placental tissues suggests a role in maintaining maternal-fetal immune tolerance during pregnancy .

How does Ccbp2 contribute to inflammatory disease pathogenesis?

Ccbp2 modulates inflammation by clearing chemokines from extracellular spaces, thereby reducing immune cell recruitment to inflamed tissues. Dysregulation of this mechanism has been linked to exacerbated inflammatory responses in conditions such as preeclampsia . Experimental studies have shown that knockdown of Ccbp2 increases trophoblast cell proliferation and migration, suggesting its role in controlling placental inflammation .

What are the molecular mechanisms underlying GAG binding in Ccbp2?

Ccbp2 contains specialized domains that interact with glycosaminoglycans (GAGs), facilitating chemokine scavenging. These interactions are distinct from those observed in other chemokines, involving oligomerization on GAGs . Biochemical analyses reveal that these domains exhibit high affinity for sulfated GAGs like heparan sulfate.

Table: Characteristics of GAG Binding Domains in Recombinant Mouse Chemokine-binding Proteins

DomainBinding AffinityFunctional Role
N-terminal domainHighScavenges CXCL8
Central domainModerateFacilitates oligomerization

How can bioinformatics tools be used to identify novel roles for Ccbp2?

Bioinformatics tools like WGCNA enable researchers to identify hub genes associated with specific diseases by analyzing co-expression networks . For example:

  • Network Analysis: Cytoscape software visualizes gene interaction networks.

  • Algorithmic Approaches: CytoHubba's MCC and DMNC algorithms pinpoint critical nodes like Ccbp2 within large datasets.

  • Validation: Public datasets confirm upregulation of Ccbp2 in disease states such as preeclampsia.

These methods provide insights into how Ccbp2 interacts with other genes involved in immune regulation.

What experimental strategies can clarify the functional roles of Ccbp2?

Experimental strategies include:

  • Gene Knockdown Studies: siRNA-mediated knockdown of Ccbp2 reveals its role in trophoblast cell behavior.

  • Chemokine Clearance Assays: Assessing the efficiency of chemokine degradation by recombinant Ccbp2.

  • Inflammatory Models: Using mouse models to study the impact of Ccbp2 deficiency on inflammation progression.

These approaches help elucidate the multifaceted roles of Ccbp2 in health and disease.

How does the structural configuration of recombinant Ccbp2 affect its function?

The structural configuration of recombinant proteins influences their binding affinity and specificity for ligands like chemokines or GAGs . Structural studies using X-ray crystallography or NMR spectroscopy reveal that mutations within binding domains can alter scavenging efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.