Recombinant Mouse Chloride intracellular channel protein 4 (Clic4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clic4; Chloride intracellular channel protein 4; mc3s5/mtCLIC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-253
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Clic4
Target Protein Sequence
ALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKR KPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDI FAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRRFLDG DEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEVE IAYSDVAKRLTK
Uniprot No.

Target Background

Function

Recombinant Mouse Chloride intracellular channel protein 4 (Clic4) inserts into membranes, forming poorly selective ion channels that may also transport chloride ions. Channel activity is pH-dependent. Membrane insertion appears redox-regulated, potentially occurring only under oxidizing conditions. Clic4 promotes cell-surface expression of HRH3 and may play a role in angiogenesis.

Gene References Into Functions

References Supporting Clic4 Function:

  1. Downregulation of CLIC4 inhibits proliferation and promotes apoptosis in mouse liver cancer Hca-F cells. PMID: 28636115
  2. CLIC-dependent chloride efflux (CLIC1, CLIC4, CLIC5) is a crucial upstream event for NLRP3 activation. PMID: 28779175
  3. Clic1 and Clic4 participate in IL-1β secretion and NLRP3 inflammasome activation; in LPS-activated macrophages, they translocate to the nucleus/cell membranes. PMID: 28576828
  4. CLIC4/CLIC5A-mediated ERM activation is essential for maintaining glomerular capillary architecture. PMID: 27582103
  5. CLIC4 is not required for collateral vessel formation but is crucial for perinatal maturation of nascent collaterals by supporting VEGF signaling. PMID: 26276819
  6. CLIC4 absence does not significantly affect functional recovery or fibrosis after acute injury. PMID: 24708746
  7. Compartmentalized CLIC4 expression in adult tissues and cells highlights potential functional roles. PMID: 24886590
  8. Increased CLIC4 expression is an early indicator and mediator of endothelial dysfunction in pulmonary hypertension. PMID: 24503951
  9. CLIC4 enhances epithelial migration, potentially via the TGF-β pathway, contributing to skin healing and corneal wound re-epithelialization. PMID: 22613027
  10. Nuclear CLIC4 is essential for macrophage deactivation. PMID: 22474389
  11. CLIC4 is necessary for optimal macrophage response to various pathogens and acts as a positive regulator of LPS signaling. PMID: 21469130
  12. S-nitrosylation regulates CLIC4 structure, protein interactions, and intracellular distribution. PMID: 20504765
  13. mtCLIC/CLIC4, a mitochondrial chloride channel protein, increases with DNA damage and participates in p53-mediated apoptosis. PMID: 11997498
  14. mtCLIC is involved in mitochondrial membrane potential generation in mitochondrial DNA-depleted cells. PMID: 12958156
  15. CLIC4 nuclear translocation is a key part of the cellular stress response and may contribute to apoptosis-associated nuclear changes. PMID: 14610078
  16. CLIC4 is crucial for angiogenesis by supporting vacuolar acidification during tubulogenesis. PMID: 19197003
  17. CLIC4 influences native collateral formation upstream of HIF-1α-VEGF signaling. PMID: 19478202
Database Links
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Cytoplasmic vesicle membrane; Single-pass membrane protein. Nucleus. Cell membrane; Single-pass membrane protein. Mitochondrion.
Tissue Specificity
Detected in blood vessels in the retina (at protein level). Expressed to the greatest extent in vivo in heart, lung, liver, kidney, and skin.

Q&A

What is the molecular structure of CLIC4 and how does it relate to its function?

CLIC4 is a member of the chloride intracellular channel protein family with a molecular mass of approximately 28 kDa. While initially classified as a chloride channel, CLIC4 exhibits a dual nature—it exists as both a soluble cytoplasmic protein and a membrane-associated protein. The protein contains N-terminal and C-terminal domains that are critical for its proper targeting and function. Research has demonstrated that the full-length CLIC4 sequence (aa 1-253) is required for proper subcellular targeting, with truncated variants (N-terminal aa 1-107 or C-terminal aa 96-253) failing to localize correctly . Structurally, CLIC4 can undergo conformational changes that allow membrane insertion under specific conditions (like oxidizing environments), which enables its ion channel activity .

What are the primary physiological roles of CLIC4 in different tissues?

CLIC4 functions in multiple physiological processes across various tissues:

Tissue/SystemPrimary FunctionsExperimental Evidence
Vascular systemPromotes angiogenesis through tubulogenesisDefective angiogenesis in Matrigel plug assays and decreased retinal vascular development in CLIC4-/- mice
Renal systemEssential for renal tubulogenesis and proximal tubule functionImpaired renal tubulogenesis and dilated proximal tubules in CLIC4-null mice
Cellular levelRegulates apical exocytosis, endosomal trafficking, and microvillus morphogenesisAbnormal apical cargo delivery and endolysosomal genesis in CLIC4-KO mice

CLIC4 supports acidification of vacuoles along cell-hollowing tubulogenic pathways, which is critical for proper lumen formation in endothelial cells . In renal development, CLIC4 is enriched in proximal tubule epithelial cells where it regulates luminal delivery, microvillus morphogenesis, and endolysosomal biogenesis .

How does CLIC4 activity change under different cellular conditions?

CLIC4's activity is regulated by several factors:

  • pH sensitivity: Channel activity depends on pH conditions, suggesting a role in pH-dependent cellular processes

  • Redox regulation: Membrane insertion appears to be redox-regulated, occurring primarily under oxidizing conditions

  • Developmental stage: CLIC4 expression patterns change during development, with specific enrichment in developing structures like renal proximal tubules

  • Subcellular localization: CLIC4 undergoes dynamic relocalization during cellular processes like luminogenesis, moving from early endosomes to recycling endosomes to apical membranes

These condition-dependent changes in CLIC4 activity suggest it serves as a multifunctional regulator responding to cellular state.

What are the optimal methods for studying CLIC4 protein expression and localization?

For comprehensive analysis of CLIC4 expression and localization, researchers should consider multiple complementary approaches:

Protein Expression Analysis:

  • Western blotting with validated CLIC4 antibodies for tissue/cell extracts

  • Quantitative RT-PCR using TaqMan QPCR assay with GAPDH as internal standard

  • Immunoprecipitation to study protein-protein interactions

Localization Studies:

  • Immunoelectron microscopy (pre-embedding protocol) which preserves both antigenic epitopes and membrane structures

  • Immunofluorescence microscopy with co-localization markers (e.g., EEA1 for early endosomes, Rab11a for recycling endosomes)

  • Live-cell imaging with GFP-CLIC4 fusion proteins to track dynamic localization

When conducting immunolocalization studies, validation in CLIC4-KO tissues/cells is critical to confirm antibody specificity. For optimal subcellular resolution, electronic microscopy has proven particularly valuable in detecting CLIC4 in specific structures like apical cytoplasmic endosomes and on microvilli .

What experimental systems are most suitable for investigating CLIC4 function?

Several experimental systems have proven effective for CLIC4 research:

Experimental SystemApplicationsKey Advantages
CLIC4 knockout miceIn vivo developmental and physiological studiesReveals tissue-specific functions in intact physiological context
MDCK 3D cyst cultureModeling early-phase renal tubulogenesisAllows detailed analysis of luminogenesis process and apical transport
LLC-PK1 cell lineStudying proximal tubule epithelial functionsModels proximal tubule-specific processes
Matrigel plug angiogenesis assayQuantifying angiogenic capacitySuitable for comparing wild-type and CLIC4-null angiogenesis
Oxygen-induced retinopathy modelInvestigating stress-responsive angiogenesisTests angiogenic response under pathological conditions

For mechanistic studies, MDCK 3D cultures are particularly valuable as they recapitulate key features of luminogenesis, allowing visualization of CLIC4's dynamic association with apical transport carriers and emerging luminal structures .

How should recombinant CLIC4 protein be handled for optimal experimental results?

When working with recombinant CLIC4 protein:

  • Reconstitution: Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex to avoid protein denaturation .

  • Storage considerations:

    • Short-term (≤1 month): Store at 2-8°C

    • Long-term: Aliquot and store at -80°C for up to 12 months

    • Avoid repeated freeze/thaw cycles that may compromise protein integrity

  • Stability assessment: The thermal stability can be monitored by accelerated thermal degradation testing (37°C for 48h). Expect loss rate under 5% within expiration date under appropriate storage conditions .

  • Applications: Recombinant CLIC4 is suitable for:

    • Positive control in expression studies

    • Immunogen for antibody development

    • SDS-PAGE standards

    • Western blotting controls

When using CLIC4 for functional studies, consider that activity may be pH-dependent and influenced by redox conditions, mirroring its physiological regulation .

How are CLIC4 knockout mice generated and what are their key phenotypes?

Generation Strategy:
The CLIC4 gene knockout has been achieved through targeted disruption of the gene, specifically by eliminating exon 2. In the knockout construct, splicing from exon 1 to exon 3 puts exon 3 out of frame and introduces a stop codon 84 bases downstream. This results in a truncated protein of only 5854 MW, containing the N-terminal 24 amino acids of CLIC4 followed by 28 irrelevant amino acids .

Validation Methods:

  • Southern blotting to confirm homologous recombination

  • Quantitative RT-PCR showing absence of intact CLIC4 mRNA

  • Western blot confirming absence of CLIC4 protein

Key Phenotypes:

SystemPhenotypeFunctional Implication
VascularDefective angiogenesis in Matrigel plug assayCLIC4 required for normal angiogenic processes
RetinalDecreased spontaneous retinal vasculature development; dramatically decreased angiogenic response to oxygen toxicity challengeCLIC4 necessary for both developmental and stress-responsive angiogenesis
RenalThinner cortex in metanephros; fewer regular-shaped tubules; increased condensed mesenchyme clustersCLIC4 essential for normal renal development
Proximal TubuleDilated proximal tubules in adult; abnormal apical cargo delivery; endolysosomal genesis and microvillus morphogenesis defectsCLIC4 maintains tubule structure and function

The phenotypic analysis indicates CLIC4's functional roles extend beyond simple ion channel activity to fundamental developmental and structural processes.

How can cellular phenotypes be accurately assessed in CLIC4-deficient models?

For comprehensive phenotypic analysis of CLIC4-deficient models:

Morphological Assessment:

  • Light microscopy with specific markers (e.g., LTA for glycoproteins, megalin for apical membrane proteins)

  • Electron microscopy to evaluate ultrastructural features (microvilli, lumen formation)

  • Immunoelectron microscopy to detect protein localization with high precision

Functional Assessment:

  • Tubulogenesis assays using endothelial cells derived from wild-type vs. CLIC4-/- mice in three-dimensional fibrin gels

  • Vacuolar pH measurements to assess acidification capacity

  • Trafficking assays to monitor movement of apical cargoes such as megalin or p75 neurotrophin receptor

Molecular Assessment:

  • Analysis of retromer components (e.g., Vps35) and their interactions

  • Evaluation of endosomal markers (EEA1, Rab11a) distribution

  • Assessment of actin cytoskeleton organization using cortactin as a marker

When comparing wild-type and CLIC4-deficient systems, it's critical to evaluate multiple parameters simultaneously, as CLIC4 functions in interconnected cellular processes affecting tubulogenesis, trafficking, and cytoskeletal organization.

What cellular processes are disrupted in CLIC4 knockout models that lead to observed phenotypes?

Multiple interconnected cellular processes are disrupted in CLIC4 knockout models:

Vacuolar Acidification Defects:

  • Vacuoles along endothelial tubulogenesis pathway fail to properly acidify in CLIC4-/- cells

  • This suggests CLIC4 supports the electrogenic vacuolar proton ATPase (vH-ATPase) by providing a short-circuiting chloride conductance

Apical Exocytosis Impairment:

  • Defective apical vesicle coalescence and central lumen formation

  • Failed targeting of critical components (e.g., PTEN) to pre-apical membrane initiation sites (AMIS)

  • Decreased enrichment of PI(4,5)P2 at nascent luminal surfaces

Endosomal Trafficking Disruption:

  • Impaired delivery of Rab11a from early endosome tubules to recycling endosomes

  • Abnormal physical separation between early endosomes and recycling endosomes

  • Loss of perinuclear/pericentriolar enrichment of Rab11a

Cytoskeletal Dysregulation:

  • Increased actin assembly on early endosomes in CLIC4-KO cells

  • Elevated cortactin association with retromer components like Vps35 and WASH1

These disrupted processes collectively result in the observed phenotypes of defective tubulogenesis, abnormal lumen formation, and proximal tubule dilation.

How does CLIC4 regulate endosomal trafficking and membrane dynamics?

CLIC4 serves as a critical regulator of endosomal trafficking through several interconnected mechanisms:

Early Endosome to Recycling Endosome Transport:
CLIC4 facilitates the delivery of Rab11a from early endosome (EE) tubules to recycling endosomes (RE). In CLIC4-deficient cells, this process is compromised, resulting in failure to form properly organized RE and loss of the normal perinuclear/pericentriolar enrichment of Rab11a . This trafficking defect appears selective, as EE-to-TGN retrograde transport of CI-MPR remains relatively normal in CLIC4-KD cells .

Actin Cytoskeleton Regulation:
CLIC4 negatively regulates branched actin formation on early endosomes. In CLIC4-KO cells:

  • Enhanced cortactin recruitment to early endosomes is observed

  • Increased cortactin specifically co-immunoprecipitates with Vps35 or WASH1

  • Abnormal actin assembly occurs on enlarged early endosomes

CLIC4 directly interacts with cortactin, binding to its actin-binding domain (aa 82-330), suggesting that CLIC4 may modulate cortactin-dependent actin organization on endosomal membranes .

Retromer-Mediated Transport:
CLIC4 selectively modulates retromer-mediated apical transport, which is critical for proper protein sorting from early endosomes. The interaction between CLIC4 and cortactin appears to regulate branched actin formation on early endosomes, which in turn affects retromer-dependent trafficking .

This multilayered regulation of endosomal dynamics by CLIC4 explains its profound impact on cellular processes like luminogenesis and tubulogenesis.

What is the relationship between CLIC4 and the actin cytoskeleton in tubulogenesis?

The relationship between CLIC4 and the actin cytoskeleton in tubulogenesis involves several key interactions:

Direct and Indirect Interactions:

  • CLIC4 directly binds to cortactin, specifically to its actin-binding domain (aa 82-330)

  • CLIC4 itself does not bind directly to F-actin in co-sedimentation assays

  • CLIC4 has been shown to bind to other actin-regulating proteins like 14-3-3 and dynamin

Regulatory Role in Early Endosome Actin Networks:
CLIC4 negatively regulates branched actin formation on early endosomes. Without CLIC4:

  • Aberrant cortactin patterns appear on early endosomes

  • Increased actin assembly occurs on these organelles

  • The amount of cortactin co-immunoprecipitated with retromer components increases significantly

Functional Consequences for Tubulogenesis:
The proper regulation of actin dynamics by CLIC4 is essential for:

  • Apical vesicle coalescence during lumen formation

  • Correct trafficking of proteins like Rab11a and PTEN to developing luminal structures

  • Microvillus morphogenesis in proximal tubule epithelial cells

This relationship explains why CLIC4 knockout leads to tubulogenic defects that can be rescued by manipulating downstream components of the pathway, such as Rab8 and Cdc42 .

What are the molecular determinants of CLIC4's membrane insertion and channel activity?

CLIC4's membrane insertion and channel activity involve several molecular determinants:

Redox Regulation:

  • Membrane insertion appears to be redox-regulated

  • Insertion preferentially occurs under oxidizing conditions

  • This suggests conformational changes in CLIC4 structure in response to cellular redox state

pH Dependence:

  • Channel activity is highly dependent on pH conditions

  • This pH sensitivity may relate to CLIC4's role in supporting vacuolar acidification

Structural Requirements:

  • The full-length CLIC4 sequence (aa 1-253) is required for proper membrane targeting

  • Truncated variants display aberrant localization:

    • N-terminal fragment (aa 1-107) localizes primarily to tight junctions

    • C-terminal fragment (aa 96-253) shows diffuse cytoplasmic and nuclear distribution

Functional Integration:
While CLIC4 generates only weak anion conductance when heterologously expressed, its expression level correlates with exocytic activity. This raises the possibility that CLIC4's primary role may be to promote the insertion of other bona fide ion channels into membranes, rather than functioning primarily as an ion channel itself .

Recent research has also identified CLIC proteins as potential fusogens, suggesting their membrane insertion may directly facilitate membrane fusion events critical for processes like tubulogenesis .

What are the contradictions in current CLIC4 research that need resolution?

Several paradoxes and contradictions in CLIC4 research warrant further investigation:

Channel vs. Non-Channel Functions:
While classified as a "chloride intracellular channel," biochemical and structural analyses show CLIC4 is primarily a cytosolic protein . When heterologously expressed, it generates only weak, poorly selective anion conductance . This raises fundamental questions about whether its primary biological functions relate to ion transport or to other processes like protein trafficking and cytoskeletal regulation.

Subcellular Localization Paradox:
CLIC4 shows remarkably diverse subcellular localization, appearing in cytoplasm, nucleus, mitochondria, endosomes, and plasma membrane . This diversity complicates the interpretation of its functional role and raises questions about what determines its localization in different cellular contexts.

Mechanistic Ambiguity in Actin Regulation:
While CLIC4 clearly affects cortactin-dependent actin organization, the precise mechanism remains unclear. It does not directly bind F-actin and does not detectably affect cortactin co-sedimentation with F-actin . The exact molecular mechanisms by which CLIC4 regulates cytoskeletal dynamics require further elucidation.

Divergent Evolutionary Functions:
The CLIC family has undergone divergent evolution (one in nematodes, two in flies, six in mammals), suggesting potentially different functions across species . Reconciling the conserved versus species-specific roles presents a challenge for translating findings across model systems.

These contradictions highlight the need for integrated approaches that can simultaneously address CLIC4's multiple potential functions.

What methodological advances would advance CLIC4 research?

Several methodological advances could significantly propel CLIC4 research forward:

Advanced Imaging Techniques:

  • Super-resolution microscopy to precisely track CLIC4 localization during dynamic cellular processes

  • Live-cell FRET sensors to monitor CLIC4 conformational changes during membrane insertion

  • Correlative light and electron microscopy (CLEM) to connect functional observations with ultrastructural details

Protein Engineering Approaches:

  • Development of conformation-specific antibodies that distinguish between soluble and membrane-inserted CLIC4

  • Creation of optogenetic CLIC4 variants that allow temporal control of its activity

  • Domain-specific CLIC4 mutants to dissect specific functions (channel vs. trafficking vs. cytoskeletal)

Cellular Systems:

  • Organ-on-chip technologies incorporating CLIC4 wild-type and mutant cells to model complex tissue environments

  • Induced pluripotent stem cell (iPSC)-derived organoids to study CLIC4 in human developmental contexts

  • CRISPR-engineered cell lines with endogenous CLIC4 tags for physiological expression level studies

Analytical Methods:

  • Quantitative proteomic approaches to comprehensively identify the CLIC4 interactome across different cellular conditions

  • Single-molecule tracking to follow CLIC4 trafficking in real-time

  • Cryo-electron microscopy to visualize membrane-inserted CLIC4 structures

These methodological advances would help resolve the mechanistic questions surrounding CLIC4's multiple cellular roles.

How might understanding CLIC4 function contribute to therapeutic approaches for vascular and renal diseases?

Understanding CLIC4 function could inform several therapeutic strategies:

Angiogenesis Modulation:
Given CLIC4's critical role in angiogenesis , modulating its function could provide new approaches for conditions requiring angiogenic control:

  • Pro-angiogenic CLIC4 enhancers might promote revascularization in ischemic diseases

  • CLIC4 inhibitors could potentially suppress pathological angiogenesis in cancer or retinopathies

Renal Tubule Dysfunction:
CLIC4's role in maintaining proximal tubule structure and function suggests therapeutic potential for renal conditions:

  • CLIC4-targeting approaches might help address proximal tubulopathies

  • Strategies to enhance CLIC4 function could potentially counteract tubular dilation in polycystic kidney disease

Cellular Trafficking Disorders:
CLIC4's fundamental role in endosomal trafficking and apical exocytosis has implications for diseases involving vesicular transport defects:

  • Compounds modulating CLIC4-dependent trafficking could address protein mislocalization disorders

  • CLIC4 pathway activators might enhance cellular clearance mechanisms in diseases with protein accumulation

Mechanistic Considerations for Drug Development:
The multifunctionality of CLIC4 suggests several potential therapeutic strategies:

  • Small molecules targeting CLIC4's membrane insertion might selectively affect its channel function

  • Compounds modulating CLIC4-cortactin interaction could specifically affect cytoskeletal regulation

  • Peptide mimetics of CLIC4 functional domains could serve as selective inhibitors of specific CLIC4 activities

Therapeutic development would need to carefully consider tissue-specific roles of CLIC4 to minimize off-target effects.

What are common pitfalls when working with recombinant CLIC4 and how can they be avoided?

Researchers working with recombinant CLIC4 should be aware of these common issues and their solutions:

Protein Stability Issues:

  • Problem: Recombinant CLIC4 may lose activity during storage or manipulation

  • Solution: Avoid vortexing during reconstitution; store at -80°C in small aliquots to prevent repeated freeze-thaw cycles; include 5% Trehalose in buffer formulations to enhance stability

Conformational Variability:

  • Problem: CLIC4 exists in multiple conformational states depending on redox conditions

  • Solution: Standardize redox conditions in experimental buffers; consider including oxidizing or reducing agents depending on which CLIC4 conformation is being studied

Endotoxin Contamination:

  • Problem: E. coli-expressed recombinant proteins may contain endotoxins that affect cellular assays

  • Solution: Verify endotoxin levels (<1.0EU per 1μg); consider endotoxin removal procedures for sensitive applications

Expression Tag Interference:

  • Problem: N-terminal His tags may affect CLIC4 function or interaction with binding partners

  • Solution: When possible, compare results with tag-cleaved protein; consider C-terminal tagged versions as alternative controls

Buffer Compatibility:

  • Problem: CLIC4 activity may be affected by buffer composition

  • Solution: Use PBS (pH 7.4) for initial reconstitution; for functional studies, empirically determine optimal buffer conditions that preserve both stability and activity

Addressing these issues will ensure more reliable and reproducible results when working with recombinant CLIC4.

How can researchers optimize 3D culture systems to study CLIC4's role in tubulogenesis?

To optimize 3D culture systems for studying CLIC4 in tubulogenesis:

Matrix Selection and Preparation:

  • Matrix type: Choose appropriate matrix based on research questions:

    • Matrigel: Suitable for general tubulogenesis studies and angiogenesis assays

    • Fibrin gels: Effective for endothelial cell tubulogenesis studies

    • Collagen: Appropriate for studies focusing on cell-ECM interactions

  • Matrix concentration: Optimize to allow cell movement while providing structural support (typically 4-8 mg/ml for collagen, 8-12 mg/ml for Matrigel)

Cell Type and Density Considerations:

  • Cell selection: Choose appropriate models based on research focus:

    • MDCK cells: Excellent for studying basic luminogenesis mechanisms

    • LLC-PK1 cells: Appropriate for proximal tubule-specific processes

    • Primary endothelial cells from WT and CLIC4-/- mice: Ideal for comparative studies

  • Seeding density: Optimize to promote tubulogenesis (typically 2-5×10^4 cells/ml for endothelial cells)

Culture Conditions and Monitoring:

  • Time course: Establish appropriate time points for analysis (early luminogenesis: 12-48h; mature structures: 3-6 days)

  • Live imaging: Implement time-lapse microscopy with fluorescent markers to track dynamic processes

  • Fixation protocols: Optimize to preserve 3D structures (4% paraformaldehyde with gentle handling)

Functional Analysis Approaches:

  • Lumen quantification: Measure lumen size, number, and connectivity

  • Molecular markers: Track apical-basolateral polarity markers to assess proper polarization

  • pH-sensitive probes: Use ratiometric probes to monitor vacuolar acidification in wild-type versus CLIC4-deficient cultures

Rescue Experiments:

  • Re-expression strategies: Establish stable or inducible expression systems for wild-type or mutant CLIC4

  • Downstream effectors: Test rescue with downstream components like Rab8 and Cdc42

  • Pharmacological interventions: Use agents like bafilomycin A1 (vH-ATPase inhibitor) to probe mechanism

These optimizations will provide robust 3D culture systems for investigating CLIC4's role in tubulogenesis.

What are the best approaches for analyzing contradictory data in CLIC4 research?

When faced with contradictory data in CLIC4 research, researchers should:

Systematic Variance Analysis:

  • Catalog discrepancies between studies, noting precise experimental conditions

  • Identify key variables that differ between contradictory studies:

    • Cell types/tissues used (endothelial vs. epithelial, primary vs. immortalized)

    • Experimental systems (in vivo vs. 3D culture vs. 2D culture)

    • CLIC4 manipulation methods (knockout vs. knockdown vs. overexpression)

  • Test hypotheses about condition-dependent effects through controlled experiments

Methodological Reconciliation:

  • Cross-validate findings using multiple complementary techniques:

    • Combine imaging with biochemical and functional assays

    • Validate antibody specificity using CLIC4-KO controls

    • Perform rescue experiments with well-characterized CLIC4 constructs

  • Address temporal dynamics that might explain contradictions:

    • CLIC4 functions differently during development versus mature tissues

    • CLIC4 localization changes during processes like luminogenesis

Multifunctional Protein Framework:

  • Consider CLIC4's multiple functions simultaneously:

    • Ion channel activity may be secondary to trafficking functions

    • Different functions may predominate in different cell types

  • Evaluate context-dependent interactions:

    • CLIC4-cortactin interaction may vary with cellular conditions

    • Redox state affects CLIC4 membrane insertion

Collaborative Resolution Strategies:

  • Direct laboratory exchanges to standardize protocols

  • Shared reagents (antibodies, cell lines, recombinant proteins)

  • Multi-lab validation studies with standardized methodologies

By systematically addressing contradictions through these approaches, researchers can develop a more cohesive understanding of CLIC4's complex cellular roles.

How does CLIC4 function as a fusogen and what implications does this have for cellular processes?

Recent research has identified CLIC proteins, including CLIC4, as potential fusogens , which has significant implications for understanding their cellular functions:

Fusogenic Mechanism:

  • CLIC proteins can directly interact with membranes and potentially facilitate membrane fusion events

  • This fusogenic activity may be directly related to CLIC4's role in tubulogenesis, where membrane fusion is essential for lumen formation

  • The ability to undergo rapid membrane translocation upon agonist stimulation may be mechanistically linked to its fusogenic properties

Relationship to Known Functions:
This emerging fusogenic role aligns with and potentially explains several established CLIC4 functions:

  • Support of intracellular tubulogenesis in endothelial cells, where vacuole fusion creates luminized structures

  • Facilitation of apical vesicle coalescence during central lumen formation

  • Regulation of endosomal trafficking, where membrane fusion events are critical

Experimental Evidence Connection:
The fusogenic hypothesis connects several experimental observations:

  • CLIC4-null mice show defects in excretory canal formation and altered angiogenesis

  • These phenotypes involve processes requiring extensive membrane remodeling

  • The in vitro ability of CLICs to directly interact with membranes supports this function

Research Implications:
Understanding CLIC4 as a fusogen opens new research directions:

  • Investigation of specific lipid interactions that facilitate CLIC4's membrane insertion

  • Examination of how CLIC4's fusogenic activity is regulated in different cellular contexts

  • Development of assays to directly measure CLIC4-mediated membrane fusion events

This emerging perspective on CLIC4 function as a fusogen may help reconcile its diverse cellular roles under a unified mechanistic framework.

What is the relationship between CLIC4 and other CLIC family members in mammalian systems?

The relationship between CLIC4 and other CLIC family members in mammals reveals both functional overlap and specialization:

Evolutionary Context:

  • Mammals express six CLIC proteins (CLIC1-6) compared to one in nematodes and two in flies

  • This expansion suggests both functional redundancy and specialization

  • CLIC4 is the mammalian homolog of EXC-4 in C. elegans, whose mutation causes cystic excretory canals

Tissue Expression Patterns:
CLIC family members show differential tissue expression:

  • CLIC4: Broadly expressed but enriched in endothelial cells and proximal tubule epithelial cells

  • CLIC5: Highly expressed in placenta, lung, and heart

  • CLIC6: Predominantly in brain and testis

Functional Commonalities:
All CLIC proteins share certain characteristics:

  • Ability to exist as both soluble and membrane-associated forms

  • Structural similarities including thioredoxin-like domains

  • Potential to generate ion conductances when inserted into membranes

Functional Specialization:
Despite similarities, CLIC proteins have distinct roles:

  • CLIC4: Critical for angiogenesis and renal tubulogenesis

  • CLIC3: Linked to the surface recycling of integrin receptors from late endosomes/lysosomes in cancer cells

  • CLIC5: Associated with stereocilia function in the inner ear

Compensatory Mechanisms:

  • Certain phenotypes in CLIC4-KO mice may be partial due to compensation by other CLIC family members

  • The severity of phenotypes in specific tissues likely reflects the degree of functional redundancy among CLICs in those tissues

Understanding these relationships is crucial for interpreting knockout studies and for developing targeted approaches to modulate specific CLIC functions while minimizing compensatory effects from other family members.

How might bioinformatic approaches advance understanding of CLIC4 function across species?

Bioinformatic approaches offer powerful tools for understanding CLIC4 function across species:

Evolutionary Sequence Analysis:

  • Comparative genomics can identify conserved domains critical for CLIC4 function

  • Phylogenetic profiling can trace the evolutionary history of CLIC proteins from the single EXC-4 in C. elegans to the six mammalian CLICs

  • Mutation tolerance mapping can identify regions under strong selective pressure

Structural Bioinformatics:

  • Homology modeling can predict structural changes associated with membrane insertion

  • Molecular dynamics simulations can model CLIC4 interactions with membrane lipids and proteins

  • Protein-protein interaction interface prediction can guide experiments on CLIC4-cortactin binding

Network Analysis:

  • Protein-protein interaction networks can place CLIC4 in the context of cellular pathways

  • Co-expression analysis across tissues can identify functional partners

  • Pathway enrichment analysis can reveal biological processes most associated with CLIC4

Multi-omics Integration:

  • Transcriptomic profiles of CLIC4-deficient models can identify downstream effectors

  • Proteomics data integration can reveal post-translational modifications regulating CLIC4

  • Single-cell analysis can identify cell populations most dependent on CLIC4 function

Predictive Modeling Applications:

  • Machine learning approaches can predict cell-type specific functions based on molecular context

  • Systems biology models can simulate effects of CLIC4 perturbation on cellular processes

  • Drug-target interaction prediction can identify potential CLIC4 modulators

These bioinformatic approaches would complement experimental data and accelerate understanding of CLIC4's complex roles across different species and cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.