Recombinant Mouse Chloride intracellular channel protein 5 (Clic5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Clic5; Chloride intracellular channel protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Clic5
Target Protein Sequence
MTDSATTNGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS KFSAYIKNTKQQNNAALERGLTKALRKLDDYLNSPLPEEIDTNTHGDEKGSQRKFLDGDE LTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA YADVARRLSRS
Uniprot No.

Target Background

Function

Chloride intracellular channel protein 5 (CLIC5) is essential for normal hearing, contributing to stereocilia formation in the inner ear and the development of the organ of Corti. It integrates into cell membranes, forming ion channels with low selectivity, potentially transporting chloride ions. CLIC5 is involved in regulating transepithelial ion absorption and secretion and is crucial for maintaining proper glomerular endothelial cell and podocyte architecture. Furthermore, it plays a vital role in lens suture formation, which is essential for maintaining normal lens optical properties.

Gene References Into Functions
  1. KLPH is required for lens-specific Clic5 expression; Clic5 is crucial for lens fiber cell extension and organization. PMID: 29425878
  2. CLICs-dependent chloride efflux is a crucial upstream event for NLRP3 activation. PMID: 28779175
  3. CLIC4/CLIC5A-mediated ERM activation is essential for maintaining glomerular capillary architecture. PMID: 27582103
  4. CLIC5 deficiency exacerbates hypertension-induced glomerular capillary injury by impairing Rac1-dependent Pak and ezrin activation, potentially reducing podocyte actin cytoskeleton strength. PMID: 26924049
  5. CLIC5A functions via clustered plasma membrane phosphatidylinositol 4,5-bisphosphate accumulation, facilitating ezrin activation and actin-dependent cell surface remodeling. PMID: 25344252
  6. CLIC5 interacts with ERM proteins, TPRN, and potentially myosin VI (MYO6). CLIC5 and RDX localization is abnormal in fused stereocilia of MYO6 mutant mice. PMID: 24285636
  7. miR-96 and miR-182 regulate CLIC5 expression in mouse inner ear hair cells. PMID: 22889583
  8. CLIC5 is a crucial component for foot process integrity and podocyte function. PMID: 20664558
  9. CLIC5 inhibits C2C12 cell proliferation and promotes myoblast differentiation by enhancing MyHC, myogenin, and desmin expression. PMID: 20055760
  10. Clic5 mutant mice exhibit resistance to diet-induced obesity. PMID: 20357015
  11. CLIC5A colocalizes with ezrin and podocalyxin in podocytes and is essential for maintaining proper glomerular endothelial cell and podocyte architecture. PMID: 20335315
  12. CLIC5 associates with radixin in hair cell stereocilia, potentially contributing to the formation or stabilization of connections between the plasma membrane and the actin core. PMID: 17021174
Database Links
Involvement In Disease
Defects in Clic5 are a cause of the jitterbug (jbg) phenotype. Jbg is the result of a spontaneous mutation that leads to severe degeneration of the organ of Corti in the inner ear. Jbg leads to progressive degeneration of inner ear hair cells. Affected mice are identified by head bobbing, circling behavior and their inability to swim. They cannot hear well when young, and become completely deaf after 5 months.
Protein Families
Chloride channel CLIC family
Subcellular Location
Golgi apparatus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Membrane; Single-pass membrane protein. Apical cell membrane; Single-pass membrane protein. Cytoplasm.
Tissue Specificity
Detected in lung and inner ear. Detected in embryonic cochlea, on microvilli-covered apical surfaces of interdental cells, columnar cells of Kolliker's organ, and on stereocilia of inner and outer hair cells (at protein level). Also detected in the eye, w

Q&A

What is the cellular localization pattern of CLIC5?

CLIC5A is predominantly expressed in the renal glomerulus, specifically in podocytes . At the subcellular level, CLIC5A localizes to both the plasma membrane and cytosol, where it associates with and is regulated by the actin cytoskeleton . In placental tissue, CLIC5 is enriched in isolated placental microvilli and, unlike CLIC1 and CLIC4, is specifically associated with the detergent-insoluble cytoskeletal fraction of microvilli . Indirect immunofluorescence microscopy has demonstrated that CLIC5 is concentrated within the apical region of trophoblast cells .

How does CLIC5 expression differ from other CLIC family members?

Northern blot analysis has shown that CLIC5 exhibits a distinct pattern of expression compared to CLIC1 and CLIC4 . While CLIC5 and CLIC4 are both enriched in isolated placental microvilli, CLIC1 is not . Additionally, immunofluorescence microscopy reveals that CLIC4 and CLIC5 are concentrated within the apical region of the trophoblast, whereas CLIC1 is distributed throughout the cytoplasm . These distinctive expression patterns suggest that each CLIC family member serves different physiological roles.

What are the primary functions of CLIC5 in cellular physiology?

While CLIC5 was initially thought to function primarily as a chloride ion channel, recent research has revealed more diverse and complex roles. Recent studies have demonstrated that CLIC5 functions as a fusogen, directly interacting with membranes and inducing fusion between liposomes . Additionally, CLIC5A, through interactions with the small GTPase Rac1, induces the phosphorylation of ezrin-moeisin-radixin (ERM) proteins and localized production of phosphatidylinositol-4,5-bisphosphate . This enables ezrin to couple transmembrane proteins to the actin cytoskeleton, potentially facilitating the formation of podocyte foot processes necessary for renal filtration . CLIC5 also plays a significant role in promoting myoblast differentiation and skeletal muscle development .

What experimental approaches can be used to investigate CLIC5's fusogenic activity?

To investigate CLIC5's fusogenic properties, researchers can employ several complementary techniques:

  • Liposome Size Analysis: Monitoring changes in liposomal diameter after CLIC5 addition using dynamic light scattering or electron microscopy .

  • Lipid Mixing Assays: Utilizing R18 (octadecyl rhodamine B chloride) fluorescent dye, which undergoes unquenching upon lipid mixing. Time-dependent R18 unquenching upon CLIC5 addition to a mixture of labeled and unlabeled liposomes indicates lipid mixing between liposomes .

  • Content Mixing Assays: Measuring the mixing of aqueous contents between liposomes using self-quenching fluorescent dyes encapsulated within separate liposome populations .

  • pH-Dependency Studies: Systematically varying pH conditions to examine how acidic environments affect CLIC5's membrane interaction and fusion capacity .

  • Mutation Analysis: Introducing site-directed mutations in the hydrophobic inter-domain interface to assess their impact on fusogenic activity .

How can researchers effectively generate and validate CLIC5 knockout models?

CLIC5 conditional knockout mice can be generated using the CRISPR-Cas9 genome editing system through the following methodology:

  • Targeting Vector Construction: Design a targeting vector inserting a flippase recombination target (Frt)-flanked neomycin cassette upstream and two loxP sites downstream of the second exon of CLIC5 .

  • Embryonic Stem Cell Electroporation: Electroporate the targeting vector into embryonic stem cells from the desired mouse strain (e.g., C57BL/6) .

  • Tissue-Specific Knockout: Generate tissue-specific CLIC5-knockout mice by crossbreeding floxed CLIC5 mice with mice expressing Cre recombinase under tissue-specific promoters .

  • Validation Methods:

    • PCR genotyping to confirm the presence of loxP sites and Cre recombinase

    • Western blotting to verify reduced CLIC5 protein expression

    • qRT-PCR to examine potential compensatory upregulation of other CLIC family members

    • Assessment of phenotypic changes, including body weight, muscle mass, and muscle stem cell proportions

What technical challenges arise when studying the membrane-transition properties of CLIC5?

Several technical challenges must be addressed when investigating CLIC5's unique ability to transition between soluble and membrane-associated states:

  • Protein Stability: Maintaining CLIC5's native conformation during purification and experimental procedures. Storage in appropriate buffer conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) and avoiding repeated freeze-thaw cycles is recommended .

  • Conformational Analysis: Capturing and characterizing the transitional states of CLIC5 requires sophisticated techniques such as X-ray crystallography, mass spectrometry, and fluorescence spectroscopy .

  • Membrane Recruitment Dynamics: Developing real-time visualization methods to observe the soluble-to-membrane transition of CLIC5 in response to triggers like pH changes or oxidative conditions .

  • Oligomerization Assessment: Determining whether CLIC5 forms oligomers during membrane insertion, which may be crucial for its channel or fusogenic activities .

  • Distinguishing Ion Channel vs. Fusogenic Activities: Designing experiments that can differentiate between these two potential functions, as the evidence for CLIC5 functioning as a bona fide ion channel remains controversial .

How does CLIC5 interact with the actin cytoskeleton, and what are the implications for cell physiology?

CLIC5 was initially isolated from placental microvilli as a component of a multimeric complex consisting of several cytoskeletal proteins, including actin, ezrin, α-actinin, gelsolin, and IQGAP1 . This association with the cytoskeleton has significant physiological implications:

  • Actin Regulation Pathway: CLIC5A activates ezrin through interaction with Rac1, inducing ERM protein phosphorylation and localized production of phosphatidylinositol-4,5-bisphosphate. This activation enables ezrin to couple transmembrane proteins to the actin cytoskeleton .

  • Structural Role in Specialized Cells: In podocytes, this CLIC5-mediated ezrin activation may be crucial for forming and maintaining foot processes necessary for proper renal filtration .

  • Muscle Development: CLIC5 promotes myoblast differentiation and skeletal muscle development, potentially through its interactions with the cytoskeleton .

  • Experimental Approaches: To study these interactions, researchers can employ:

    • Detergent fractionation to isolate cytoskeleton-associated protein complexes

    • Co-immunoprecipitation to identify CLIC5 binding partners

    • Fluorescence microscopy to visualize co-localization with cytoskeletal elements

    • Actin polymerization assays to assess functional effects

What are the optimal conditions for recombinant CLIC5 protein expression and purification?

Based on established protocols for recombinant CLIC5 production:

  • Expression System: E. coli is an effective system for recombinant CLIC5 expression .

  • Protein Tags: N-terminal His-tag facilitates purification while maintaining protein functionality .

  • Purification Method: Affinity chromatography using nickel columns, followed by size exclusion chromatography to ensure purity.

  • Storage Conditions:

    • Lyophilized powder form for long-term storage

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

  • Quality Control: Verify protein purity (>90%) by SDS-PAGE and confirm functionality through membrane interaction assays .

What techniques are most effective for studying CLIC5's membrane interactions in vitro?

Several complementary approaches can be employed to investigate CLIC5's membrane interactions:

  • Liposome Co-Sedimentation Assays: Following incubation of CLIC5 with liposomes, centrifugation separates membrane-bound protein (pellet) from free protein (supernatant). Fractions can be analyzed by fluorescence measurement and SDS-PAGE .

  • R18 Lipid Mixing Assay: Originally developed to investigate viral fusion events, this assay uses self-quenching octadecyl rhodamine B chloride (R18) incorporated into liposomes. Lipid mixing upon fusion leads to dye dilution and increased fluorescence .

  • Content Mixing Assays: To distinguish between full fusion and hemifusion, researchers can encapsulate soluble dyes within liposomes and monitor their mixing upon CLIC5 addition .

  • pH-Sensitivity Experiments: Systematically varying buffer pH during membrane interaction experiments helps characterize the pH-dependency of CLIC5's membrane association and fusogenic activity .

  • NBD-Labeled Lipid Assay: Used to assess whether CLIC5 possesses scramblase activity (ability to translocate lipids between membrane leaflets) .

How can researchers effectively analyze CLIC5 alternative splicing and isoform-specific functions?

To investigate the two CLIC5 splice variants (CLIC5A and CLIC5B) and their distinct functions:

  • Isoform-Specific Detection:

    • Design PCR primers spanning unique exon junctions to specifically amplify each variant

    • Develop isoform-specific antibodies targeting unique epitopes

    • Use mass spectrometry to distinguish between isoforms based on molecular weight differences

  • Expression Analysis:

    • Quantitative RT-PCR to measure relative expression of each isoform across tissues

    • Western blotting with isoform-specific antibodies to quantify protein levels

    • Immunohistochemistry to determine tissue and cellular localization patterns

  • Functional Comparison:

    • Generate recombinant proteins of each isoform for in vitro activity assays

    • Develop isoform-specific knockdown or knockout models

    • Compare phenotypic effects of selective isoform manipulation

  • Structure-Function Analysis:

    • Identify unique domains or motifs in each isoform

    • Create chimeric proteins to determine which regions are responsible for isoform-specific functions

What phenotypic analyses are most informative when studying CLIC5 knockout models?

Based on reported CLIC5 deficiency phenotypes, researchers should consider the following analyses:

  • Developmental Metrics:

    • Body weight monitoring from 3 weeks of age (showing 9.67% reduction in male and 5.55% reduction in female CLIC5 knockout mice at 9 weeks)

    • Muscle mass measurements, particularly of tibialis anterior and gastrocnemius muscles

  • Cellular Composition:

    • Fluorescence-activated cell sorting (FACS) to quantify muscle stem cell populations (reduced from 11.15% to 8.22% in CLIC5 knockout hind limbs)

    • Histological analysis of muscle fiber type and size

  • Auditory and Vestibular Function:

    • Auditory brainstem response testing to detect progressive hearing loss

    • Vestibular function tests to assess balance and coordination

  • Renal Function:

    • Urinalysis to detect proteinuria

    • Kidney histology to assess podocyte foot process morphology

    • Glomerular filtration rate measurements to evaluate filtration capacity

  • Cytoskeletal Organization:

    • Immunofluorescence microscopy to visualize actin cytoskeleton

    • Assessment of ERM protein phosphorylation status

    • Analysis of Rac1 activation and phosphatidylinositol-4,5-bisphosphate levels

What emerging technologies could advance our understanding of CLIC5 biology?

Several cutting-edge approaches hold promise for elucidating CLIC5's functions:

  • Cryo-Electron Microscopy: To visualize CLIC5's membrane-associated structures and potential oligomeric states at near-atomic resolution.

  • CRISPR-Based Screening: To identify genetic interactors and signaling pathways connected to CLIC5 function.

  • Live-Cell Single-Molecule Imaging: To track CLIC5's dynamic behavior during membrane association and fusion events in real-time.

  • Tissue-Specific Proteomics: To comprehensively identify CLIC5 binding partners in different cellular contexts.

  • Organoid Models: To study CLIC5's role in three-dimensional tissue organization, particularly in kidney and muscle development.

How might researchers resolve the controversy regarding CLIC5's ion channel function?

The debate about whether CLIC5 functions as a bona fide ion channel requires systematic investigation:

  • Refined Electrophysiology: Employing patch-clamp techniques on reconstituted membranes containing purified CLIC5 under strictly controlled conditions.

  • Ion Selectivity Assays: Using fluorescent ion indicators to directly measure chloride, cation, or anion flux in CLIC5-containing vesicles.

  • Structure-Guided Mutagenesis: Creating mutations in putative pore-forming regions and assessing their impact on ion conductance.

  • Comparative Analysis: Directly comparing CLIC5's channel-forming properties with well-established chloride channels.

  • Integration of Functions: Investigating whether CLIC5's fusogenic and ion channel activities are mechanistically linked or represent distinct functions in different contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.