Recombinant Mouse Chloride intracellular channel protein 6 (Clic6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Clic6; Chloride intracellular channel protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Clic6
Target Protein Sequence
MAEATEPKEVAPGSQGQPEGATIEGPGEPGAADLEGREASEEAAEAPRDLGAGVEARASG KEEGGCGQDEGTGGAQAQDPRTGPEAETPGASGAPGEAEAAERDPEGAIPQGAEEAPSAQ QVQGMSSGLDSQGEAPEVPGDSRREPEDPTASEAGEEAESGQEAQGGGALGLQINPEVQG LAGDNMDTEAPAGGPLGSESEPQGGGESSPQPQDEAIEIVTTEIGGNESGELAGASAADA AGEGETLGKDGSEEAASEDARVDAHENGDQGKLQEETGEEEARPEPELKGPCEGAIQEKP PDGSLDGEEAKSTEHEEESQAELSNHLAEEPSVQGGEELGRVNGRRENGPALEEGDPGQE HDITLFVKAGYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPP FMTFDGEVKTDVNKIEEFLEEKLVPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDA NEIYEKNLLRALKKLDSYLNSPLPDEIDADSSEDVTVSQRKFLDGDELTLADCNLLPKLH IIKIVAKKYRDFEFPSEMTGIWRYLNNAYARDEFTNTCPADREIEHAYSDAAKRMK
Uniprot No.

Target Background

Function

This protein may insert into cell membranes to form chloride ion channels. It may play a crucial role in water-secreting cells, potentially through the regulation of chloride ion transport.

Database Links
Protein Families
Chloride channel CLIC family
Subcellular Location
Cytoplasm. Cell membrane; Single-pass membrane protein.

Q&A

What is mouse CLIC6 and how does it compare to other CLIC family members?

CLIC6, also known as parchorin, is the most recently discovered and longest isoform in the CLIC protein family. It shares structural homology with other CLIC proteins and belongs to the glutathione s-transferase superfamily . CLIC6 is present in the conserved gene cluster ACD (AML/CLIC/DSCR1-like) on chromosome 21, while related family members CLIC4 and CLIC5 are located on chromosomes 4 and 6, respectively . This chromosomal organization suggests potential overlapping distribution and functional properties among these channels. CLIC6 can transition between soluble and transmembrane forms, with the soluble structure having been resolved, though its membrane structure remains unknown .

What is the tissue distribution pattern of mouse CLIC6?

Quantitative RT-PCR analysis has revealed that CLIC6 mRNA is most abundantly expressed in lung tissue, followed by moderate expression in the brain . Lower expression levels have been detected in heart, kidney, liver, spleen, soleus muscle, and brown fat . This tissue-specific expression pattern suggests specialized physiological roles in respiratory and neural tissues. Researchers studying CLIC6 should consider these expression patterns when designing experiments and selecting appropriate cell models.

What are the basic biophysical properties of recombinant mouse CLIC6?

When expressed in HEK-293 cells, CLIC6 localizes to the plasma membrane and forms functional ion channels with the following properties:

  • Selectivity: CLIC6 is more permeable to chloride (Cl⁻) compared to bromide (Br⁻), fluoride (F⁻), and potassium (K⁺) ions, with a selectivity sequence of Cl⁻ >> Br⁻ = F⁻

  • Voltage dependence: The channel exhibits voltage-dependent gating (V₁/₂ = 14.062 mV) with fast gating that closes at negative membrane voltages and opens upon depolarization

  • Pharmacology: CLIC6 currents are inhibited by IAA-94 (a CLIC-specific blocker) at a concentration of 10 μM, with approximately 48 ± 5% block at positive holding potentials

  • Single-channel properties: Displays multiple conductance levels including a main conductance state and substates (at approximately 50% of the main state)

What expression systems are most effective for studying recombinant mouse CLIC6?

HEK-293 cells have been successfully used to express functional recombinant mouse CLIC6 . When transfected into these cells, CLIC6 localizes to the plasma membrane where it can be studied using electrophysiological approaches . This system offers several advantages:

  • High transfection efficiency and protein expression levels

  • Low background of endogenous chloride channels (though some IAA-94-insensitive chloride currents are present)

  • Compatibility with various experimental techniques including immunofluorescence, patch-clamp recording, and biochemical assays

For physiologically relevant studies, mouse lung epithelial (MLE) cells are recommended as they naturally express CLIC6 and exhibit IAA-94-sensitive chloride currents that are abolished following CLIC6 knockdown .

How can the functional properties of recombinant mouse CLIC6 be assessed electrophysiologically?

Patch-clamp electrophysiology provides the most direct method for assessing CLIC6 channel activity:

  • Whole-cell recording technique:

    • Use NMDG-Cl solutions (135 mM NMDG-Cl in bath, 130 mM NMDG-Cl in pipette)

    • Apply voltage steps from -100 mV to +100 mV to observe voltage-dependent activation

    • Measure tail currents at -40 mV to assess voltage dependency

    • Add 10 μM IAA-94 to confirm CLIC6-mediated currents (expect ~48% block at positive potentials)

  • Single-channel recording (cell-attached configuration):

    • Use asymmetric chloride concentrations (130 mM in pipette, 4.2 mM cytoplasmic)

    • Record at both +100 mV and -100 mV for comprehensive assessment

    • Look for multiple conductance states including substates

    • Apply 10 μM IAA-94 to observe decreased open probability (Po) by ~50%

  • Automated patch-clamp approach:

    • Systems like SyncroPatch 384i can be used for higher throughput screening

    • Parameters including seal resistance, capacitance, and series resistance should be monitored

What methods can be used to assess ion selectivity of recombinant mouse CLIC6?

Ion selectivity can be determined using whole-cell patch-clamp with ion substitution protocols:

  • Establish baseline recording with standard NMDG-Cl solutions

  • Sequentially replace bath solution with equimolar NMDG-Br, NMDG-F, KCl, or KMeSO₄

  • Measure current amplitudes and reversal potentials (Er) under each condition

  • Calculate relative permeabilities using the Goldman-Hodgkin-Katz equation

Expected results based on published data:

  • Er for Cl⁻: approximately -40 mV

  • Er for Br⁻ and F⁻: approximately -60 mV

  • Significantly reduced current amplitudes with Br⁻ and F⁻ compared to Cl⁻

  • Minimal current with K⁺ as the primary permeant ion

How is recombinant mouse CLIC6 regulated by pH and what residues are involved?

CLIC6 activity is regulated by pH, with subtle functional changes observed when pH is altered from 7.2 to 6.2 . Key findings include:

Researchers studying pH regulation of CLIC6 should focus on this key residue and consider the implications of histidine protonation on channel conformation and function.

How does redox regulation affect recombinant mouse CLIC6 and what are the key residues involved?

CLIC6 is regulated by redox conditions, similar to other CLIC family members:

  • Addition of the reducing agent dithiothreitol (DTT, 2 mM) significantly decreases CLIC6 current amplitude by approximately 40%

  • The cysteine residue at position 487 (C487) appears to be the primary redox sensor:

    • C487 corresponds to C24 in CLIC1, which is established as a redox sensor

    • Mutation of C487 to alanine (C487A) significantly reduces channel activity

    • C487A mutation abolishes the response to DTT

The rapid response to DTT (within 100 milliseconds) suggests that redox modification directly affects channel gating rather than membrane insertion, which would require longer timeframes .

What are the structural domains of CLIC6 critical for its channel function?

While the complete transmembrane structure of CLIC6 remains unresolved, functional studies have identified key domains:

  • N-terminal domain containing C487 - critical for redox sensing and regulation

  • C-terminal domain containing H648 - important for pH sensitivity

  • Putative transmembrane regions that form the ion-conducting pore

Comparison with other CLIC proteins suggests that CLIC6 likely undergoes a major conformational change during transition from soluble to membrane-integrated forms, exposing hydrophobic surfaces that mediate membrane insertion . Research focused on structure-function relationships should target these key domains through mutagenesis and functional assays.

What is the potential role of CLIC6 in lung physiology?

Given the high expression of CLIC6 in lung tissue and functional presence in mouse lung epithelial (MLE) cells, this channel likely plays important roles in pulmonary physiology:

  • MLE cells display robust chloride currents that are partially blocked by IAA-94 (33 ± 10%), indicating CLIC6 contribution

  • Knockdown of CLIC6 using shRNA eliminates the IAA-94-sensitive component of chloride currents while leaving other chloride channels intact

  • Genome-wide association studies have linked CLIC6 to lung function

Researchers studying CLIC6 in lung physiology should consider its potential roles in:

  • Fluid secretion and absorption across epithelial surfaces

  • Regulation of membrane potential in airway cells

  • Cellular responses to oxidative stress

  • pH regulation in intracellular compartments

What is the evidence for CLIC6 involvement in cancer and other pathological conditions?

CLIC6 has been implicated in several pathological conditions:

  • Cancer: CLIC6 has been associated with breast, ovarian, lung, gastric, and pancreatic cancers . This suggests potential roles in:

    • Tumor cell proliferation

    • Invasion and metastasis

    • Response to oxidative stress in the tumor microenvironment

  • Other conditions: Genome-wide association studies have linked CLIC6 to:

    • Psoriasis

    • Lung function abnormalities

    • Accelerated aging associated with alcohol use

    • Therapeutic targets in cancer treatment

  • Cell death: While the search results don't provide specific details about CLIC6, they mention that knockdown of CLIC genes can induce cell death and increase intracellular calcium levels in insect cell lines , suggesting conserved roles in cell survival pathways.

How does CLIC6 interact with dopamine receptors and what are the potential implications?

CLIC6 is known to interact with dopamine (D₂-like) receptors, though the functional significance remains incompletely understood :

  • Co-transfection studies with dopamine D3-receptors in CHO cell lines have yielded mixed results regarding CLIC6-mediated chloride fluxes

  • The interaction suggests potential roles in:

    • Dopaminergic neurotransmission

    • Receptor trafficking and internalization

    • Signal transduction pathways downstream of dopamine receptors

Researchers investigating this interaction should consider:

  • Co-immunoprecipitation assays to confirm physical interaction

  • Functional studies in neuronal cell models

  • Effects of dopamine receptor activation on CLIC6 localization and function

  • Potential roles in neurological and psychiatric disorders involving dopaminergic signaling

What are the current technical challenges in studying recombinant mouse CLIC6?

Several technical challenges complicate CLIC6 research:

  • Dual localization: CLIC6 exists in both soluble and membrane-integrated forms, making it difficult to isolate and study specific pools of the protein

  • Structural complexity: The membrane structure remains unresolved, limiting structure-based studies and rational drug design

  • Functional overlap: Other chloride channels may compensate for CLIC6 function, complicating knockout/knockdown studies

  • Tissue-specific expression: The relatively restricted expression pattern (primarily lung and brain) limits the availability of primary cell models

  • Pharmacological limitations: While IAA-94 blocks CLIC6, it also affects other CLIC family members, limiting its utility for selective targeting

What are the recommended approaches for generating and validating CLIC6 knockdown or knockout models?

For effective genetic manipulation of CLIC6:

  • RNA interference:

    • shRNA delivered via lentiviral vectors has been successfully used to knockdown CLIC6 in mouse lung epithelial cells

    • Co-expression of a fluorescent reporter (e.g., RFP) enables identification of transduced cells

    • Validation by qPCR is essential to confirm reduced CLIC6 expression

  • CRISPR-Cas9 knockout:

    • Target conserved regions in early exons to ensure complete loss of function

    • Validate genomic modifications by sequencing

    • Confirm protein absence by Western blot

    • Assess functional consequences using electrophysiology (absence of IAA-94-sensitive currents)

  • Functional validation:

    • Compare IAA-94 sensitivity before and after genetic manipulation

    • Assess chloride flux using fluorescent indicators

    • Examine subcellular localization of other CLIC family members to detect potential compensation

How can researchers distinguish between direct CLIC6 effects and indirect cellular responses?

Distinguishing direct CLIC6 functions from secondary effects requires:

  • Acute vs. chronic manipulation:

    • Acute pharmacological inhibition (IAA-94)

    • Inducible genetic systems for time-controlled knockdown

    • Comparison of immediate vs. delayed cellular responses

  • Structure-function studies:

    • Use point mutations (e.g., C487A, H648A) that affect specific functions without eliminating the protein

    • Compare phenotypes of different mutations to isolate mechanism-specific effects

  • Reconstitution experiments:

    • Express CLIC6 in heterologous systems lacking endogenous CLIC proteins

    • Use purified protein in artificial membrane systems to assess direct biophysical properties

  • Simultaneous measurement approaches:

    • Combine electrophysiology with fluorescent indicators of other cellular parameters (e.g., pH, calcium, ROS)

    • Correlate CLIC6 activity with other cellular responses in real-time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.