Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 2A (Cmtm2a)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

CMTM2A is synthesized using cell-free expression systems or mammalian cell lines, depending on the vendor:

Cell-Free Expression (ALiCE® System)

  • Expression Host: Nicotiana tabacum (tobacco) lysate

  • Tagging: Strep Tag for affinity purification

  • Yield: >70–80% purity via SDS-PAGE and analytical SEC

  • Buffer: PBS pH 7.4 with 10% glycerol (standard)

Mammalian Expression

  • Host: HEK-293 cells (for other CMTM2A variants)

  • Tagging: His tag (alternative to Strep Tag)

Functional Roles in Biological Systems

CMTM2A plays critical roles in male fertility and cancer regulation:

Sperm Function and Fertility

  • Localization: Plasma membrane of sperm heads

  • Phenotype in Mutants:

    Genetic MutationObservation
    Cmtm2a−2/−2; Cmtm2b+444/+444Immotile sperm, reduced zona pellucida binding
    Cmtm2a; Cmtm2b−15/−15Similar defects, suggesting CMTM2A/B redundancy
  • Mechanism: Regulates ADAM3 (a sperm membrane protein critical for migration and fertilization)

Tumor Suppression

  • Cancer Types: Hepatocellular carcinoma, linitis plastica, salivary gland adenoid cystic carcinoma

  • Role: Inhibits tumor cell invasion and migration

Research Findings and Emerging Directions

  1. Compensatory Role in Sperm Function: CMTM2A and CMTM2B are functionally interchangeable in maintaining sperm motility and membrane integrity .

  2. Cancer Biomarker Potential: Reduced CMTM2A expression correlates with aggressive hepatocellular carcinoma phenotypes .

  3. Structural Insights: The MARVEL domain’s role in protein-protein interactions remains under investigation .

References

  1. Antikoerper-online.de (2019). CMTM2A Protein (AA 1-169) (Strep Tag)

  2. PMC (2018). Co-expression of sperm membrane proteins CMTM2A and CMTM2B

  3. J Cell Sci (2018). Mammalian sperm relies on transmembrane chemokine-like proteins

  4. Gene Biosystems (2024). Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 2A

  5. Wikipedia (2008). CMTM2

  6. NCBI Gene (2020). Cmtm2a

  7. Rat Genome Database (2008). Cmtm2a

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
Cmtm2a; Cklfsf2a; CKLF-like MARVEL transmembrane domain-containing protein 2A; Chemokine-like factor superfamily member 2A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cmtm2a
Target Protein Sequence
MAAPIKFPFRPRGGQPREDTTPKRGLRRYLLELKESNKEFWLSGHAVFKLLSLGCMISAL DYFETMLPHPVLILLICMEAAICIFFIFLNTLAINRYIPFVFWPMADIFNSLFSCVFLGG GIYFAFKARRLLPKPYLTAMILMGAAAICSFIDMLLQFQHFRGLRLRKW
Uniprot No.

Target Background

Gene References Into Functions
  1. Collectively, these findings suggest that ARR19 may play a crucial role in the differentiation of male reproductive organs, such as the testis and prostate. PMID: 26260329
  2. In conclusion, the temporal expression pattern of CKLF1 coincides with postnatal developmental stages, and its spatial locations correspond to neural cell migration destinations or regions where myelination normally occurs. PMID: 22587964
  3. ARR19 functions as a novel coregulator of Nur77, thereby regulating Nur77-induced testicular steroidogenesis. PMID: 20472563
  4. Overexpression of chemokine-like factor 2 promotes the proliferation and survival of C2C12 skeletal muscle cells. PMID: 12183067
  5. ARR19 may act as an androgen receptor corepressor in vivo and play a significant role in male reproductive functions. PMID: 14576337
  6. Research indicates that mouse chemokine-like factors (CKLF) 2, 4, 5, and 6 are four splicing variants homologous to human CKLFs. Furthermore, murine CKLFs exhibit distinct characteristics compared to their human counterparts. PMID: 14672409
  7. Data demonstrate that mouse Cklfsf2a and Cklfsf2b are two homologues of human CKLFSF2. PMID: 16343975
  8. ARR19 gene expression in testicular Leydig cells is regulated by luteinizing hormone/cAMP signaling via the control of GATA-1 expression, leading to the regulation of testicular steroidogenesis. PMID: 19398553

Show More

Hide All

Database Links
Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Cmtm2a and what is its biological function?

Cmtm2a is a transmembrane protein belonging to the CMTM family (CKLF-like MARVEL transmembrane domain containing). Unlike typical chemokines that are secreted to induce chemotaxis during immune responses, Cmtm2a is a membrane-bound protein with specialized functions. Research has demonstrated that Cmtm2a, in conjunction with Cmtm2b, plays a critical role in male fertility by affecting sperm function . Specifically, these proteins are required for the proper localization of the sperm membrane protein ADAM3, which is essential for sperm fertilizing ability . Cmtm2a and Cmtm2b are part of a gene cluster on mouse chromosome 8 that includes several CMTM family members .

Where is Cmtm2a expressed in mice?

Cmtm2a shows an exclusively testis-specific expression pattern in mice. RT-PCR analysis reveals that while some CMTM family members (Cmtm3, Cmtm4, and Cklf) are expressed ubiquitously across tissues, Cmtm1, Cmtm2a, and Cmtm2b are exclusively expressed in mouse testes . Temporal expression analysis indicates that Cmtm2a expression begins approximately two weeks after birth, corresponding with the onset of spermatogenesis . At the subcellular level, immunostaining studies have demonstrated that Cmtm2a localizes to the plasma membrane of the sperm head, where it functions in sperm-egg interactions .

What is the relationship between Cmtm2a and Cmtm2b?

Mouse Cmtm2a and Cmtm2b are both homologs of human CMTM2, which is highly expressed in testicular germ cells . These proteins appear to have complementary or compensatory functions in male fertility. Evidence for this functional relationship comes from CRISPR/Cas9-generated mutant mice studies showing:

GenotypeFertility StatusPregnancy RateMean Litter Size
Wild-typeFertile94.4% (29/31 plugs)Normal
Cmtm1 single mutantFertileSimilar to wild-typeNormal
Cmtm2a/Cmtm2b double mutant (Line 1)Infertile0% (0/25 plugs)N/A
Cmtm2a/Cmtm2b double mutant (Line 2)Subfertile48.4% (15/31 plugs)Reduced

The difference in fertility between the two double mutant lines relates to the nature of the mutations: Line 1 represents complete knockout of both genes, while Line 2 contains an in-frame mutation of Cmtm2a (15 bp deletion) and a frameshift mutation of Cmtm2b (8 bp deletion) .

How should recombinant Cmtm2a protein be stored for experimental use?

For optimal stability and activity, recombinant Cmtm2a protein should be stored according to these guidelines:

  • Store at -20°C for routine storage

  • For extended storage periods, maintain at -80°C

  • Avoid repeated freeze-thaw cycles, which can compromise protein integrity

  • Prepare working aliquots and store at 4°C for up to one week

  • The protein is typically maintained in a Tris-based buffer with 50% glycerol, specifically optimized for this protein

These storage recommendations ensure that the protein maintains its structural integrity and biological activity for research applications.

What experimental approaches have been used to successfully study Cmtm2a function in vivo?

The most definitive approach for studying Cmtm2a function in vivo has been the generation of knockout mice using CRISPR/Cas9 technology. Researchers have established a quick and efficient system to analyze male fertility using CRISPR/Cas9-mediated mutant mice . This approach involves:

  • Creating targeted deletions or insertions in the Cmtm2a gene

  • Generating both single and double mutant mice (with Cmtm2b) to assess compensatory effects

  • Validating mutations through genotyping PCR, direct sequencing, and RT-PCR analysis

  • Confirming protein disruption via immunoblot analysis

  • Examining testicular histology and sperm morphology

  • Evaluating male fertility through breeding trials and quantification of pregnancy rates

This systematic approach has revealed that while Cmtm1 mutant mice remain fertile, Cmtm2a and Cmtm2b double mutant mice exhibit significant fertility defects due to impaired sperm function . The CRISPR/Cas9 system provides several advantages over traditional knockout methods, including faster generation of mutant mice, the ability to create multiple mutations simultaneously, and reduced off-target effects when properly designed .

How does disruption of Cmtm2a affect sperm function and fertility?

The disruption of Cmtm2a, particularly when combined with Cmtm2b disruption, has profound effects on sperm function and fertility through several mechanisms:

  • ADAM3 Mislocalization: Double mutant mice show altered localization of the sperm membrane protein ADAM3, which is critical for sperm-egg interaction .

  • Sperm-Egg Binding Defects: Spermatozoa from double mutant mice exhibit reduced capacity to bind to the zona pellucida of oocytes, a crucial step in fertilization .

  • Preserved Sperm Morphology: Interestingly, spermatozoa from mutant mice appear morphologically normal under phase-contrast microscopy, indicating that the defect is functional rather than structural .

  • Dose-Dependent Effects: The severity of fertility impairment correlates with the extent of protein disruption. Complete knockout of both proteins (Line 1) results in complete infertility, while partial disruption (Line 2) leads to subfertility .

These findings establish Cmtm2a and Cmtm2b as new members of the ADAM3-associated protein family, which regulates sperm fertilizing ability. The data suggest that these proteins function in a complementary manner to ensure proper membrane protein organization in spermatozoa.

What are optimal expression systems for producing functional recombinant Cmtm2a?

Several expression systems have been used to produce recombinant Cmtm2a, each with specific advantages for different research applications:

Expression SystemPurityAdvantagesApplications
HEK-293 Cells>90%Proper folding and post-translational modifications; One-step affinity purificationStructural studies, functional assays, antibody production
Cell-free Protein Synthesis70-80%Rapid production; Avoids cellular toxicityInitial screening, pilot studies

For HEK-293 cell expression, the protein is typically tagged (often with His or Strep tags) to facilitate purification via affinity chromatography . Quality control is performed using Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) .

The choice of expression system should be determined by the intended application, with mammalian cell systems generally preferred for functional studies of membrane proteins like Cmtm2a due to their ability to properly fold the protein and incorporate it into membranes .

How can researchers verify the specificity of antibodies against Cmtm2a?

Ensuring antibody specificity is critical for accurate Cmtm2a research. A comprehensive validation strategy should include:

  • Knockout Validation: Compare antibody reactivity between wild-type and Cmtm2a knockout samples. Complete absence of signal in knockout tissues provides strong evidence of specificity .

  • Cross-Reactivity Assessment: Due to high sequence similarity, check for cross-reactivity with Cmtm2b and other CMTM family members through:

    • Western blotting of samples expressing individual CMTM proteins

    • Immunoprecipitation followed by mass spectrometry

    • Competitive binding assays with recombinant proteins

  • Multiple Detection Methods: Validate antibody performance across applications:

    • Western blotting (expected ~19 kDa band)

    • Immunohistochemistry (testis-specific staining)

    • Immunofluorescence (membrane localization in sperm)

  • Recombinant Protein Controls: Include purified recombinant Cmtm2a as a positive control in validation experiments .

Researchers should also be aware that different antibodies may work optimally for different applications, and validation should be performed for each intended use.

What experimental designs can elucidate the interaction between Cmtm2a and ADAM3?

To investigate the molecular mechanism by which Cmtm2a affects ADAM3 localization, researchers can implement several complementary experimental approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of Cmtm2a and ADAM3 in mammalian cells

    • Perform reciprocal Co-IPs to detect direct or indirect interactions

    • Include appropriate controls (IgG, lysates from knockout mice)

    • Analyze complexes by mass spectrometry to identify additional components

  • Proximity Labeling Approaches:

    • Generate Cmtm2a-BioID or Cmtm2a-APEX2 fusion proteins

    • Express in testicular cells or transgenic mice

    • Identify proteins in close proximity through biotinylation and streptavidin pull-down

    • Validate ADAM3 proximity and identify additional nearby proteins

  • Live-Cell Imaging:

    • Create fluorescent protein fusions of Cmtm2a and ADAM3

    • Track co-localization during sperm development and capacitation

    • Perform FRET analysis to detect direct interactions

    • Compare wild-type patterns with various mutant constructs

  • Domain Mapping:

    • Generate truncation and point mutants of Cmtm2a

    • Assess which domains are necessary for ADAM3 localization

    • Create chimeric proteins between Cmtm2a and Cmtm2b to identify unique functions

This multi-faceted approach can reveal whether Cmtm2a interacts directly with ADAM3 or influences its localization through effects on membrane organization or trafficking pathways.

How can researchers design CRISPR/Cas9 experiments to study Cmtm2a with minimal off-target effects?

Optimizing CRISPR/Cas9 experiments for Cmtm2a studies requires careful consideration of several factors:

  • Guide RNA Design:

    • Select target sequences with high on-target efficiency and minimal off-target potential

    • Use computational tools to predict and avoid potential off-target sites

    • Design multiple gRNAs targeting different exons to increase knockout efficiency

    • Avoid sequences with high homology to Cmtm2b unless intentionally targeting both genes

  • Mutation Strategy Selection:

    • For complete knockout: Target early exons to disrupt the open reading frame

    • For domain-specific analysis: Create precise in-frame deletions or substitutions

    • For Cmtm2a/Cmtm2b comparison: Design parallel mutations in homologous regions

  • Comprehensive Validation:

    • Confirm mutations by genomic PCR and sequencing

    • Verify altered transcript expression through RT-PCR

    • Validate protein disruption by Western blotting

    • Check for compensatory upregulation of related genes

  • Control Experiments:

    • Include wild-type controls in all experiments

    • Generate single and double mutants to assess redundancy

    • Perform rescue experiments with wildtype cDNA to confirm specificity

This approach has been successfully used to generate several lines of Cmtm2a and Cmtm2b mutant mice, revealing their roles in male fertility .

What are the key differences between in-frame and frameshift mutations in Cmtm2a functional studies?

The functional consequences of different mutation types in Cmtm2a have significant implications for research interpretation:

Mutation TypeExampleProtein EffectPhenotypic Consequence
Frameshift2 bp deletion (Line 1)Complete protein disruptionComplete loss of function
In-frame15 bp deletion (Line 2)Deletion of 5 amino acidsPartial retention of function

Research with Cmtm2a/Cmtm2b double mutants demonstrates these differences clearly:

  • Complete Protein Disruption: In Line 1 (2 bp deletion in Cmtm2a and 444 bp insertion in Cmtm2b), immunoblot analysis confirmed the absence of both proteins, resulting in complete male infertility (0% pregnancy rate) .

  • Partial Protein Function: In Line 2 (15 bp in-frame deletion in Cmtm2a and 8 bp deletion in Cmtm2b), a slightly smaller CMTM2A protein remained detectable, and males exhibited subfertility (48.4% pregnancy rate) .

These findings highlight the importance of carefully characterizing the molecular consequences of CRISPR/Cas9-induced mutations. In-frame deletions may retain partial function, potentially obscuring phenotypes in functional studies. When designing mutations for Cmtm2a research, researchers should consider whether complete loss-of-function or more subtle alterations better suit their experimental goals.

How can researchers design experiments to study potential redundancy between Cmtm2a and Cmtm2b?

To investigate the compensatory relationship between Cmtm2a and Cmtm2b, researchers should implement a multi-level experimental approach:

  • Gene Expression Analysis:

    • Quantify Cmtm2b expression in Cmtm2a knockout mice and vice versa

    • Use qRT-PCR, RNA-seq, and protein quantification to detect compensatory upregulation

    • Analyze expression patterns across development and in different testicular cell populations

  • Sequential Knockdown/Knockout Experiments:

    • Generate conditional knockout systems for temporal control of gene disruption

    • Disrupt Cmtm2a first, then Cmtm2b (and vice versa) to assess adaptive responses

    • Use both in vitro and in vivo models to examine compensatory mechanisms

  • Protein Domain Swapping:

    • Create chimeric proteins containing domains from both Cmtm2a and Cmtm2b

    • Express these in knockout backgrounds to identify functionally equivalent regions

    • Assess rescue of phenotypes with heterologous expression

  • Interactome Analysis:

    • Compare protein interaction partners of Cmtm2a and Cmtm2b

    • Identify shared versus unique binding partners

    • Map interaction networks in wild-type versus single mutant backgrounds

This systematic approach can reveal the molecular basis for the observed redundancy between these proteins and explain why double knockout mice show fertility defects while single mutants remain fertile .

What methodologies are most effective for studying Cmtm2a localization during spermatogenesis?

To accurately characterize Cmtm2a localization throughout spermatogenesis, researchers should employ complementary imaging and biochemical approaches:

  • Stage-Specific Immunohistochemistry:

    • Collect testis sections from mice at different developmental stages

    • Use validated anti-Cmtm2a antibodies with appropriate controls

    • Co-stain with markers of specific spermatogenic stages

    • Quantify expression patterns across cell types and developmental stages

  • Super-Resolution Microscopy:

    • Apply techniques like STORM or STED for nanoscale localization

    • Use dual-color imaging to assess co-localization with ADAM3 and other membrane proteins

    • Track dynamic changes during sperm maturation and capacitation

  • Immuno-Electron Microscopy:

    • Precisely localize Cmtm2a at the ultrastructural level

    • Determine membrane topology and specific membrane domains

    • Quantify gold particle distribution in different sperm regions

  • Biochemical Fractionation:

    • Isolate membrane microdomains (e.g., lipid rafts) from sperm cells

    • Analyze Cmtm2a distribution across fractions

    • Compare wild-type distribution with mutant samples

This multi-technique approach has revealed that Cmtm2a localizes to the plasma membrane on the sperm head and affects the localization of ADAM3 , providing crucial insights into its function in fertilization.

How can researchers effectively analyze the impact of Cmtm2a mutations on sperm-egg interaction?

To comprehensively evaluate how Cmtm2a affects sperm-egg interaction, researchers should implement a multi-parameter assessment strategy:

  • In Vitro Fertilization (IVF) Assays:

    • Compare fertilization rates between wild-type and mutant sperm

    • Assess zona pellucida binding capacity

    • Evaluate sperm-egg fusion efficiency

    • Quantify fertilization outcomes (pronuclear formation)

  • Zona Pellucida Penetration Tests:

    • Measure the ability of sperm to penetrate isolated zona pellucida

    • Use time-lapse imaging to quantify penetration kinetics

    • Compare acrosome reaction timing and efficiency

  • Sperm Migration Assays:

    • Assess sperm transport through the female reproductive tract

    • Quantify sperm numbers at the fertilization site

    • Evaluate sperm retention in the oviductal reservoir

  • Molecular Profiling of Capacitation:

    • Monitor tyrosine phosphorylation patterns during capacitation

    • Assess calcium signaling in response to zona proteins

    • Compare membrane fluidity and protein reorganization during capacitation

These approaches can reveal specific defects in the fertilization process caused by Cmtm2a mutations. Research has already demonstrated that double mutants of Cmtm2a and Cmtm2b have defects in male fertility due to improper ADAM3 localization , affecting the sperm's ability to interact with the egg's zona pellucida.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.