Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 3 (Cmtm3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cmtm3; Cklfsf3; CKLF-like MARVEL transmembrane domain-containing protein 3; Chemokine-like factor superfamily member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cmtm3
Target Protein Sequence
MWPPDAEPEPDPESAHGPRSGRTVPGLRALLPARAFLCSLKGRLLLAESGLSFITFICYV VSSASAFLTVPLLEFLLAVYFLFADAMQLNDKWQGLCWPMMDFLRCVTAALIYFVISITA VAKYSDGAYKAAGVFGFFATIVFAIDFYLIFNEVAKFLKQGDSGNETTAHRTEEENSNSD SDSD
Uniprot No.

Target Background

Database Links
Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CMTM3 and what is known about its structure and function?

CMTM3 belongs to the CKLF-like MARVEL transmembrane domain-containing family (CMTM), which consists of nine genes: CKLF and CMTM1 to CMTM8. The CMTM family plays major roles in immune and inflammatory responses as well as in tumorigenesis . CMTM3 is specifically located at chromosome 16q22.1 and encodes a transmembrane protein with MARVEL (MAL and related proteins for vesicle trafficking and membrane link) domains .

Methodologically, researchers investigating CMTM3 structure should consider:

  • X-ray crystallography or cryo-electron microscopy for detailed structural analysis

  • Computational modeling based on homology with other MARVEL domain-containing proteins

  • Protein-protein interaction studies to identify binding partners

The protein functions in multiple cellular processes including regulation of cell proliferation, cell differentiation, and cell morphogenesis as revealed by functional and pathway enrichment analyses .

How is CMTM3 expression regulated in normal and pathological conditions?

CMTM3 expression is regulated at multiple levels:

Transcriptional regulation: Promoter analysis has shown that transcription factors Sp1 and Sp3 can regulate CMTM3 expression. Experimental approaches using luciferase reporter assays with the CMTM3 promoter have confirmed this regulation .

Epigenetic regulation: In vitro methylation assays on the CMTM3 promoter fragment using Sss I methylase have demonstrated that DNA methylation can silence CMTM3 expression . This mechanism may explain the downregulation of CMTM3 observed in several cancer types.

Tissue-specific expression: Expression levels vary significantly between different tissue types. For example, CMTM3 is lowly expressed in hepatocellular carcinoma (HCC) cell lines compared to normal liver tissue .

Pathological regulation: In sepsis, CMTM3 is upregulated and critically regulates neutrophil migration . In contrast, CMTM3 expression is reduced in several carcinomas including testicular cancer .

What are the conflicting roles of CMTM3 in different cancer types?

CMTM3 displays dual roles in cancer progression depending on cancer type:

Tumor Suppressor Role:

  • In hepatocellular carcinoma: Overexpression of CMTM3 inhibits proliferation, invasion, and epithelial-mesenchymal transition (EMT) in HCC cells

  • In testicular cancer: Re-expression of CMTM3 induces cell cycle arrest and apoptosis through upregulation of p21, APAF1, BAX, and BCL10

Oncogenic Role:

For researchers studying this duality, methodological approaches should include:

  • Cancer-specific knockout and overexpression models

  • Comparative pathway analysis between different cancer types

  • Patient-derived xenografts to validate in vitro findings

How does CMTM3 interact with key signaling pathways in cancer?

CMTM3 has been shown to interact with several critical signaling pathways:

JAK2/STAT3 Pathway:

  • In hepatocellular carcinoma, overexpression of CMTM3 significantly downregulates phosphorylation of JAK2 and STAT3

  • This suppression of JAK2/STAT3 signaling contributes to inhibition of EMT and metastasis in HCC

Hedgehog and Wnt Signaling:

  • Functional and pathway enrichment analyses have shown that CMTM3 is involved in Hedgehog signaling pathway and Wnt signaling pathway in pancreatic cancer

  • These pathways are critical regulators of cancer cell stemness and tumor progression

ECM-receptor Interaction:

  • CMTM3 affects ECM-receptor interaction pathways, which may explain its role in cancer cell invasion and migration

To investigate these interactions, researchers should:

  • Perform co-immunoprecipitation to identify direct protein-protein interactions

  • Use pathway-specific inhibitors to dissect mechanism

  • Employ phospho-specific antibodies to track activation states of pathway components

What is the role of CMTM3 in immune regulation and sepsis?

CMTM3 has recently been identified as a critical regulator of immune responses, particularly in sepsis:

Neutrophil Migration and Activation:

  • CMTM3 knockout improves survival rate of septic mice by mitigating inflammatory responses and ameliorating organ damage

  • Mechanistically, deletion of CMTM3 reduces expression of Toll-like receptor 4 (TLR4) on neutrophils, leading to decreased expression of C-X-C motif chemokine receptor 2 (CXCR2) on cell membrane

Reduced Inflammatory Response:

  • CMTM3 knockout reduced the release of TNF-α, IL-1β, and IL-10 in peripheral blood of CLP (cecal ligation and puncture) sepsis model mice

  • Expression of organ injury markers (AST, ALT, sCr) was also lower in knockout mice

Neutrophil Distribution:

  • CMTM3 deletion results in reduced migration of neutrophils from bone marrow to bloodstream and subsequently to vital organs

  • This was confirmed through IHC staining showing lower neutrophil infiltration in tissues of knockout mice

Table: Impact of CMTM3 Knockout on Inflammatory Markers in Sepsis

MarkerWild Type (CLP)CMTM3 KO (CLP)Significance
TNF-αElevatedReducedp<0.05
IL-1βElevatedReducedp<0.05
IL-10ElevatedReducedp<0.05
ASTElevatedReducedp<0.05
ALTElevatedReducedp<0.05
sCrElevatedReducedp<0.05

How does CMTM3 function as an immune checkpoint regulator?

Recent research suggests CMTM3 may serve as a novel immune checkpoint regulator:

Correlation with Immune Cells:

  • CMTM3 expression is closely associated with cancer-associated fibroblasts, macrophages, myeloid dendritic cells, and endothelial cells

  • These cells collectively contribute to the immunosuppressive tumor microenvironment

Association with Immune Markers:

  • CMTM3 is positively correlated with immune activation genes, immune suppressor genes, and established immune checkpoints

  • It also correlates with chemokines and their receptors, which are important for immune cell trafficking

Impact on Tumor Microenvironment:

  • Increased CMTM3 leads to increased cancer-associated cells, potentially modulating protumor immune microenvironment and helping tumors achieve immune escape

  • This may explain why CMTM3 expression correlates with poor prognosis in many cancer types

Research methodologies to investigate this function should include:

  • Single-cell RNA sequencing of tumor microenvironment

  • Multiplex immunohistochemistry to visualize immune cell distribution

  • Co-culture systems with immune and cancer cells

  • Checkpoint blockade experiments in combination with CMTM3 modulation

What are the most effective methods for studying CMTM3 function in vitro?

Overexpression Studies:

  • Adenoviral vectors (Ad-CMTM3) have been successfully used to overexpress CMTM3 in cancer cell lines

  • Transfection efficiency should be verified through qRT-PCR and western blot

Gene Silencing Approaches:

  • siRNA and shRNA targeting CMTM3 have been employed to knockdown expression

  • CRISPR-Cas9 system provides more complete knockout and can be used for stable cell line generation

Functional Assays:

  • Proliferation Assays: CCK8 assays have effectively measured the impact of CMTM3 on cell proliferation

  • Colony Formation: Surviving colonies (≥50 cells per colony) are fixed with methanol, stained with crystal violet, counted and photographed

  • Migration Assays: Wound-healing assays and transwell assays have demonstrated CMTM3's effect on cell migration

  • Apoptosis Assays: Flow cytometry using Annexin V-FITC/PI has successfully measured CMTM3-induced apoptosis

Mechanistic Studies:

  • Human Apoptosis RT² Profiler PCR Array containing 84 known apoptotic genes can monitor expression changes induced by CMTM3

  • Western blotting for pathway components (e.g., cleaved caspase-3, caspase-9, PARP) helps elucidate mechanisms

What animal models are appropriate for studying CMTM3 in cancer and inflammation?

Cancer Models:

  • Xenograft models using Balb/c nude mice have demonstrated that CMTM3 overexpression attenuates tumor growth in vivo

  • Cell line-derived xenografts should be established by subcutaneous injection of cells (e.g., 5 × 10^6 cells) in the right flank

Sepsis and Inflammation Models:

  • Cecal ligation and puncture (CLP) sepsis model in CMTM3 knockout mice has effectively demonstrated CMTM3's role in inflammation

  • LPS-induced endotoxemia model provides an alternative approach to study CMTM3 in acute inflammation

Genetic Models:

  • Systemic CMTM3 knockout mice have been developed using appropriate targeting strategies

  • Tissue-specific conditional knockout models using Cre-loxP technology would be valuable for studying organ-specific effects

Assessment Methods:

  • Survival analysis (Kaplan-Meier)

  • Histopathological analysis using H&E staining

  • Immunohistochemistry for neutrophil infiltration (Ly6G staining)

  • Flow cytometry of peripheral blood and bone marrow

  • Measurement of inflammatory cytokines (TNF-α, IL-1β, IL-10)

How can researchers assess CMTM3's impact on immune cell function?

Neutrophil Isolation and Functional Assessment:

  • Neutrophils can be isolated from bone marrow and peritoneal lavage fluid to assess chemotaxis ability

  • Transwell migration assays with chemoattractants provide quantitative measurements

Flow Cytometry Analysis:

  • Surface expression of key receptors (TLR4, CXCR2) can be measured on neutrophils and monocytes

  • Multi-parameter flow cytometry allows simultaneous assessment of multiple markers

Neutrophil Distribution Studies:

  • Comparative analysis of neutrophil populations in bone marrow versus peripheral blood

  • Analysis can be performed using markers like Ly6G and CD11b

Rescue Experiments:

  • Overexpression of interacting partners (e.g., TLR4) in CMTM3 knockout models can validate mechanistic hypotheses

  • These experiments should include appropriate controls with empty vectors

How does CMTM3 expression correlate with patient prognosis in different cancers?

CMTM3 shows divergent prognostic associations depending on cancer type:

Negative Prognostic Indicator:

Positive Prognostic Indicator:

  • In hepatocellular carcinoma: Low expression correlates with poorer outcomes

  • CMTM3 is a protective factor in patients with THCA, THYM, OS, and ESCC

Research methods to establish prognostic value include:

  • Kaplan-Meier survival analysis with log-rank tests

  • Univariate and multivariate Cox regression analysis

  • Analysis of various clinical endpoints (OS, PFI, DSS)

What is the potential of CMTM3 as a therapeutic target?

CMTM3 shows promise as a therapeutic target in multiple contexts:

Cancer Therapy:

  • In pancreatic cancer: Targeting overexpressed CMTM3 could inhibit tumor progression

  • In hepatocellular carcinoma: Restoring CMTM3 expression might suppress metastasis

Sepsis Treatment:

  • Targeting CMTM3 could ameliorate the dysregulation of neutrophil migration and multi-organ damage in sepsis

  • This approach holds promise for improving outcomes in severe inflammatory conditions

Immunotherapy Adjuvant:

  • As a potential immune checkpoint regulator, targeting CMTM3 might enhance responses to existing immunotherapies

  • Combination approaches might overcome resistance to checkpoint inhibitors

Therapeutic development strategies should include:

  • Development of small molecule inhibitors targeting CMTM3-protein interactions

  • Gene therapy approaches to modulate CMTM3 expression

  • Antibody-based therapies targeting CMTM3 in appropriate contexts

  • Combination strategies with existing standard-of-care treatments

What techniques are most effective for measuring CMTM3 expression in patient samples?

Protein-Level Detection:

  • Immunohistochemistry (IHC) has been successfully used to quantify CMTM3 expression in patient tissues

  • Western blotting provides semi-quantitative assessment in tissue lysates

mRNA-Level Detection:

  • Quantitative real-time PCR (qRT-PCR) allows sensitive measurement of CMTM3 transcript levels

  • RNA-seq provides comprehensive transcriptomic context for CMTM3 expression

Data Analysis Approaches:

  • Expression differences between tumor and normal tissue can be analyzed using Mann-Whitney U test (Wilcoxon rank sum test) when data doesn't follow normal distribution

  • Correlation with clinical parameters requires appropriate statistical methods based on data distribution

Bioinformatic Resources:

  • TCGA and GTEx databases provide valuable reference data for CMTM3 expression across cancer types

  • ImmuCellAI and TIMER2 databases can be used to correlate CMTM3 expression with immune cell infiltration

What are the key unanswered questions about CMTM3 biology?

Several critical aspects of CMTM3 biology remain to be elucidated:

Tissue-Specific Functions:

  • How does CMTM3 function differ between tissue types?

  • What accounts for its tumor-suppressive versus oncogenic roles in different contexts?

Regulation of Expression:

  • What are the upstream regulators of CMTM3 beyond Sp1/Sp3?

  • How is CMTM3 expression regulated post-transcriptionally?

Structural Biology:

  • What is the detailed 3D structure of CMTM3?

  • How does structure inform function in different cellular contexts?

Interaction Network:

  • What is the complete interactome of CMTM3?

  • How do these interactions differ between normal and pathological states?

How might single-cell approaches advance our understanding of CMTM3?

Single-cell technologies offer powerful new approaches to understand CMTM3 biology:

Single-Cell RNA Sequencing:

  • Can reveal cell-type specific expression patterns of CMTM3

  • May identify previously unknown cellular populations expressing CMTM3

  • Could elucidate heterogeneity in CMTM3 expression within tumors

Spatial Transcriptomics:

  • Would provide spatial context to CMTM3 expression within tissues

  • Could reveal microenvironmental influences on CMTM3 function

Single-Cell Proteomics:

  • May identify post-translational modifications of CMTM3

  • Could reveal cell-type specific protein interaction networks

Integrative Approaches:

  • Combining single-cell data with bulk tissue analyses would provide comprehensive understanding

  • Integration with clinical outcomes data could identify cellular signatures associated with response to therapy

Human CMTM3 and mouse Cmtm3 show significant conservation, allowing for translational research between model systems and human disease applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.