Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 5 (Cmtm5)

Shipped with Ice Packs
In Stock

Description

Introduction to Cmtm5

Cmtm5 (CKLF-like MARVEL transmembrane domain-containing protein 5) is a member of the CMTM family, characterized by a MARVEL transmembrane domain and four transmembrane helices . In mice, it is encoded by the Cmtm5 gene and exists as multiple isoforms (e.g., isoforms 2 and partial fragments) . Recombinant Cmtm5 refers to lab-produced versions of this protein, commonly used to study its biological roles in neurology, oncology, and immunology .

Production and Characterization

Recombinant mouse Cmtm5 is produced via heterologous expression systems, including E. coli, yeast, baculovirus, or mammalian cells . Key characteristics include:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells (e.g., HEK293)
Purity≥85% (SDS-PAGE validated)
Protein LengthPartial fragments (e.g., 1–223 amino acids for human orthologs)
IsoformsIsoform 2, partial fragments (Cklfsf5, 1500005P16Rik)
TaggingOptional tags (e.g., His-tag, GST) for purification

Amino Acid Sequence (Partial):
mLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM... (human ortholog reference) .

Functional Roles in Mice

Cmtm5 is primarily studied for its role in oligodendrocyte function and axonal integrity in the central nervous system (CNS):

Key Findings

  • Axonal Protection: In Cmtm5-deficient mice, oligodendrocytes fail to maintain axonal integrity, leading to progressive axonopathy. This phenotype resembles Wallerian degeneration and is independent of myelin ultrastructure .

  • Demyelination Models: In cuprizone-induced demyelination and experimental autoimmune encephalomyelitis (EAE), Cmtm5 expression declines in oligodendrocytes, suggesting a role in neurodegenerative diseases like multiple sclerosis .

  • Tumor Suppression: While human CMTM5 isoforms (e.g., CMTM5-v1) inhibit cancer cell growth via EGFR signaling , mouse-specific oncogenic roles remain under investigation.

Research Applications

Recombinant Cmtm5 is employed in:

ApplicationMethod
ELISADetection of Cmtm5 in biological samples
Western BlotValidation of protein expression in oligodendrocytes
Cell Culture StudiesFunctional assays in Oli-neu (oligodendrocyte) cells to study ER stress
CRISPRi KnockdownSilencing Cmtm5 to assess axonal degeneration mechanisms

Table 1: Cmtm5’s Role in Axonal Integrity

ModelObservationReference
Cmtm5-KO MiceProgressive axonopathy in CNS; no myelin defects
Cuprizone ModelReduced Cmtm5 expression in oligodendrocytes during demyelination
EAE ModelDecreased Cmtm5 in spinal cord white matter

Table 2: Tumor Suppression (Human Context)

Cancer TypeMechanismReference
Hepatocellular CarcinomaRestored CMTM5 inhibits proliferation and induces apoptosis
Renal Cell CarcinomaCMTM5 overexpression arrests cell cycle and reduces migration
Prostate CancerCMTM5-v1 downregulates EGFR signaling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your requirements.
Synonyms
Cmtm5; Cklfsf5; CKLF-like MARVEL transmembrane domain-containing protein 5; Chemokine-like factor superfamily member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cmtm5
Target Protein Sequence
MFSAWDRRERPPEEGAAAGLQGFGVDKTFLSSLKGILLETELALTFIIFICFTASISAYM AAALLEFLITLAFLFLCATQYYQRFDRLNWPCLDFLRCLSAIVIFLVVSFAAVTSREGAA IAAFVFGIILVSVFAYDAFKIYRTELMPSTTEGDQQ
Uniprot No.

Target Background

Database Links
Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of mouse Cmtm5?

Mouse Cmtm5, like its human homolog, belongs to the CKLF-like MARVEL transmembrane domain-containing family. This protein family consists of 9 proteins (CKLF and CMTM1-8) that share structural similarities while demonstrating functional diversity . The mouse Cmtm5 gene produces multiple isoforms (Cmtm5-v1 to Cmtm5-v6) through alternative splicing, with Cmtm5-v1 being the most extensively studied . The protein contains MARVEL (MAL and related proteins for vesicle trafficking and membrane link) domains that are characteristic of proteins involved in membrane apposition events. Understanding these structural features is essential for investigating protein-protein interactions and designing targeted research approaches.

What are the physiological functions of Cmtm5 in normal mouse tissues?

In normal physiological contexts, Cmtm5 appears to play roles in:

  • Immune system regulation through chemokine-like activities

  • Cardiovascular system maintenance

  • Cell cycle regulation in normal tissue homeostasis

Current evidence suggests that Cmtm5 is primarily expressed in normal cells and tissues, with significant downregulation observed in various cancer types . For comprehensive understanding of physiological functions, spatial and temporal expression profiling across developmental stages and tissue types is recommended.

What techniques are most effective for detecting Cmtm5 expression in mouse models?

For robust detection of Cmtm5 expression, researchers should consider multiple complementary approaches:

  • Transcript analysis:

    • Quantitative RT-PCR using isoform-specific primers

    • RNA sequencing for comprehensive isoform profiling

    • In situ hybridization for spatial localization

  • Protein detection:

    • Immunohistochemistry for tissue samples (shown effective in multiple studies)

    • Western blotting for quantitative analysis

    • Flow cytometry for cellular expression profiling

    • ELISA for secreted isoforms

When analyzing Cmtm5 expression, researchers should be aware that epigenetic silencing, particularly promoter methylation, often contributes to its downregulation in cancer contexts . Therefore, combining expression analysis with methylation studies often provides more comprehensive insights.

How is Cmtm5 expression regulated at the molecular level?

Cmtm5 expression is regulated through multiple mechanisms:

  • Epigenetic regulation: Promoter methylation is a primary mechanism of Cmtm5 silencing in multiple cancer cell lines, including HCC . Treatment with demethylating agents such as 5-aza-2′-deoxycytidine can restore expression.

  • Transcriptional regulation: While specific transcription factors regulating Cmtm5 aren't detailed in the search results, analyzing the promoter region for transcription factor binding sites would provide valuable insights.

  • Post-transcriptional regulation: Alternative splicing generates multiple isoforms (v1-v6), though regulatory mechanisms controlling splice variant expression require further investigation.

Understanding these regulatory mechanisms is crucial for developing experimental strategies to modulate Cmtm5 expression in research settings.

What experimental evidence supports Cmtm5's tumor suppressor function in mouse models?

Multiple lines of evidence establish Cmtm5 as a tumor suppressor:

Cmtm5 Expression in HCC vs. Normal Tissues
Tissue Type
Normal Liver (n=76)
HCC Tissues (n=76)

How does Cmtm5 restoration affect cancer cell behavior in experimental models?

Restoring Cmtm5 expression in cancer cells produces multiple anti-cancer effects:

  • Cell proliferation: Significantly decreased proliferation in Huh7 cells at 48h and 72h post-transfection as measured by CCK-8 assay

  • Apoptosis induction: Significantly higher apoptosis rates in Cmtm5-expressing cells compared to controls, mediated through:

    • Upregulation of pro-apoptotic proteins (Bax, Bad, cleaved caspase3)

    • Downregulation of anti-apoptotic proteins (Bcl2)

  • Metastasis inhibition: Reduced cell migration and invasion in transwell assays

  • In vivo tumor suppression: Xenograft tumors with Cmtm5 overexpression showed:

    • Slower growth curve

    • Significantly reduced tumor weight

These findings provide robust evidence for multi-faceted tumor suppressor functions and suggest potential therapeutic applications for recombinant Cmtm5.

What molecular pathways are modulated by Cmtm5 in cancer contexts?

Cmtm5 exerts its tumor suppressor functions through several key signaling pathways:

  • PI3K/AKT pathway modulation:

    • Cmtm5 overexpression downregulates PI3K/AKT signaling

    • Treatment with PI3K inhibitor LY294002 (10 μM) produces similar effects to Cmtm5 overexpression

  • Downstream effectors:

    • Cell cycle regulators: Reduced cyclinD1 and cyclinE, increased p21

    • Apoptosis regulators: Increased Bax, Bad, cleaved caspase3; decreased Bcl2

    • Invasion mediators: Decreased MMP2 and MMP9 expression

Understanding these pathway interactions is essential for designing combination treatments and predicting potential resistance mechanisms in therapeutic applications.

What are optimal approaches for producing recombinant mouse Cmtm5 for research applications?

For producing recombinant mouse Cmtm5:

  • Expression system selection:

    • Mammalian expression systems (HEK293, CHO cells) are preferred for maintaining proper post-translational modifications

    • Lentiviral vectors (e.g., pLenti6.3-CMTM5-IRES-EGFP) have been successfully used for stable expression

  • Purification strategy:

    • Affinity chromatography using epitope tags (His, FLAG)

    • Size exclusion chromatography for further purification

    • Endotoxin removal for in vivo applications

  • Quality control:

    • Western blot confirmation of expression and integrity

    • Functional assays to verify biological activity

    • Endotoxin testing for in vivo applications

When designing recombinant constructs, researchers should consider which isoform (v1-v6) is most relevant to their research question, as functional differences between isoforms remain to be fully characterized.

What considerations are important when designing Cmtm5 overexpression or knockdown experiments?

For effective manipulation of Cmtm5 expression:

  • Overexpression approaches:

    • Lentiviral delivery systems have shown high efficiency in multiple cell lines

    • Include appropriate controls (empty vector) and verification of expression levels

    • Consider isoform specificity (v1-v6) based on research question

    • Inducible systems may be preferable for studying temporal effects

  • Knockdown/knockout strategies:

    • siRNA for transient knockdown

    • shRNA for stable knockdown

    • CRISPR/Cas9 for complete knockout

    • Verify knockdown/knockout efficiency at both mRNA and protein levels

  • Experimental timeline considerations:

    • For proliferation studies, significant differences may only become apparent after 48-72 hours

    • Apoptosis effects should be measured at multiple time points (24, 48, 72 hours)

  • Functional readouts:

    • Proliferation: CCK-8 assay has shown sensitivity for Cmtm5-mediated effects

    • Apoptosis: Annexin V/PI staining and flow cytometry

    • Migration/invasion: Transwell assays

What in vivo models are most appropriate for studying Cmtm5 functions?

For investigating Cmtm5 in vivo:

  • Xenograft models:

    • Subcutaneous injection of Cmtm5-modified cancer cells in immunocompromised mice

    • Monitor tumor growth curve, volume, and weight

    • Perform immunohistochemistry on tumors for pathway analysis

  • Genetic mouse models:

    • Cmtm5 knockout mice for studying physiological functions

    • Tissue-specific conditional knockout using Cre-loxP system

    • Combination with cancer-prone genetic backgrounds to study tumor suppressor function

  • Measurement parameters:

    • Tumor volume measurements over time

    • Terminal tumor weight analysis

    • Histopathological examination

    • Immunohistochemistry for pathway markers

    • Metastasis evaluation in appropriate models

When designing in vivo experiments, consider that Cmtm5 secretion into extracellular spaces may produce systemic effects beyond the primary tumor site.

How do the different Cmtm5 isoforms (v1-v6) compare in their functional properties?

While Cmtm5-v1 is the most studied isoform, comprehensive comparative analysis of all six isoforms remains an important research gap. When investigating isoform-specific functions:

  • Structural considerations:

    • Analyze domain organization differences between isoforms

    • Identify unique protein interaction motifs in specific isoforms

  • Expression patterns:

    • Determine whether isoforms show tissue-specific or condition-specific expression

    • Investigate whether isoform ratios change in disease states

  • Functional comparisons:

    • Compare tumor suppressor potency across isoforms

    • Assess isoform-specific effects on signaling pathways

    • Evaluate secretion patterns and extracellular functions

This research area represents an important frontier for understanding the complexity of Cmtm5 biology and potentially identifying isoform-specific therapeutic targets.

What are the mechanisms of Cmtm5 downregulation in different cancer types?

Understanding the mechanisms of Cmtm5 downregulation is crucial for developing strategies to restore its expression:

  • Epigenetic silencing:

    • Promoter methylation appears to be the primary mechanism in multiple cancer types

    • Histone modifications may also contribute to silencing

  • Genetic alterations:

    • Analyze cancer genomics databases for mutations, deletions, or structural variations

    • Investigate copy number variations in the Cmtm5 locus

  • Transcriptional regulation:

    • Identify key transcription factors and their dysregulation in cancer

    • Analyze promoter polymorphisms that may affect expression

  • Post-transcriptional regulation:

    • Investigate microRNA-mediated regulation

    • Analyze mRNA stability and translation efficiency

Research approaches combining these perspectives will provide comprehensive understanding of regulatory mechanisms that could be targeted therapeutically.

How might recombinant Cmtm5 be developed as a therapeutic agent?

Developing Cmtm5 as a therapeutic agent requires addressing several key research questions:

  • Delivery systems:

    • Protein-based approaches: Recombinant Cmtm5 with targeting moieties

    • Gene therapy approaches: Viral vectors for in situ expression

    • Cell-based approaches: Engineered cells secreting Cmtm5

  • Pharmacokinetics/pharmacodynamics:

    • Half-life determination and enhancement strategies

    • Tissue distribution and tumor penetration analysis

    • Dose-response relationships for anti-tumor effects

  • Combination strategies:

    • With PI3K/AKT pathway inhibitors for synergistic effects

    • With demethylating agents to simultaneously restore endogenous expression

    • With conventional chemotherapeutics or immunotherapies

  • Biomarker development:

    • Identify patient populations most likely to respond to Cmtm5-based therapies

    • Develop companion diagnostics for treatment selection

Translating the tumor suppressor functions of Cmtm5 into effective therapeutic strategies represents an exciting frontier in cancer research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.