Recombinant Mouse CKLF-like MARVEL transmembrane domain-containing protein 7 (Cmtm7)

Shipped with Ice Packs
In Stock

Description

Key Features of Recombinant Mouse CMTM7

AttributeDetail
AA Range1–167 amino acids (truncated variant)
Purification TagStrep Tag (for affinity chromatography-based purification)
Expression SystemCell-free protein synthesis (CFPS) using Nicotiana tabacum (tobacco plant) or bacterial systems .
Molecular Weight~15.3 kDa (predicted for human isoform; mouse variant may vary slightly)
Purity>70–80% (verified via SDS-PAGE, Western blot, and analytical SEC)
SequenceMSHGSGLVRT TCSSGGALGP GQPSEGLLDR VYPLTHGALF KVAQMVTLLI AFICVRSSVP IDYGAHSFFE VVTMCDLIMI LIFYLVHLFR FYRVLTCISW PLSELLHYLI GTLLLLIASI VIASKSYNQS GLVAGAIFGF LASFLCLASL WLSYKITCIT QSSDASA

Recombinant Protein Synthesis

Recombinant Mouse CMTM7 is produced via cell-free protein synthesis (CFPS), a method that bypasses traditional cell-based systems to enhance yield and flexibility. This approach allows precise control over reaction conditions, enabling the production of complex membrane proteins like CMTM7, which contains hydrophobic transmembrane domains.

Purification Strategy

The Strep Tag enables efficient purification via affinity chromatography, leveraging the high affinity of Strep-Tactin® resin for the Strep Tag. This method minimizes contamination and ensures high-quality protein recovery .

Common Use Cases

ApplicationDetails
ELISAQuantitative analysis of CMTM7 expression in biological samples or validation of antibody specificity.
Western Blot (WB)Detection of CMTM7 in lysates or membrane fractions to study subcellular localization.
SDS-PAGEElectrophoretic separation to confirm protein size and purity.
Functional AssaysStudying interactions with immune receptors (e.g., B-cell receptors) or tumor suppressor pathways in murine models .

Role in Immune Regulation

  • Tumor Microenvironment: CMTM7 is associated with immune-hot tumors in humans, correlating with increased immune cell infiltration and chronic inflammation .

  • M2 Macrophages: Elevated CMTM7 expression in M2 macrophages promotes immunosuppressive microenvironments, contributing to poor prognosis in cancers like hepatocellular carcinoma (HCC) .

Tumor Suppression

  • EGFR/AKT Signaling: In human non-small cell lung cancer (NSCLC), CMTM7 knockdown enhances tumor growth and metastasis by delaying EGFR internalization and degradation .

  • Wnt/β-Catenin Pathway: CMTM7 regulates β-catenin degradation, inhibiting stem-like traits in breast cancer cells .

Limitations

  • Sparse Mouse-Specific Data: Most functional studies focus on human or zebrafish CMTM7 .

  • Tag Interference: The Strep Tag may influence protein folding or receptor interactions in functional assays.

Research Opportunities

  • Preclinical Models: Using Recombinant Mouse CMTM7 to study tumor suppression in murine xenografts.

  • Therapeutic Targeting: Exploring inhibitors like fasudil or arachidonyltrifluoromethane, predicted to bind CMTM7 in silico .

References

  1. Creative BioMart. Recombinant Full Length Human CMTM7 Protein. Retrieved from Creative BioMart .

  2. Antibodies-Online. Recombinant Mouse CMTM7 Protein (ABIN3129915). Retrieved from Antibodies-Online .

  3. PMC. CMTM7 knockdown increases tumorigenicity of human non-small cell lung cancer. PMC4747392 .

  4. Oncotarget. CMTM7 knockdown increases tumorigenicity of human non-small cell lung cancer. Oncotarget 6 (2015) .

  5. PMC. CMTM7 recognizes an immune-hot tumor microenvironment. PMC9770089 .

  6. Boster Bio. CMTM7 (NM_181472) Human Recombinant Protein. Retrieved from Boster Bio .

  7. Nature. CMTM7 shapes the chronic inflammatory and immunosuppressive tumor microenvironment. Nature 415 (2024) .

  8. PMC. CMTM7 inhibits breast cancer progression by regulating Wnt/β-catenin signaling. PMC9960403 .

  9. Frontiers in Genetics. CMTM7 recognizes an immune-hot tumor microenvironment. Frontiers in Genetics 13 (2022) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
Cmtm7; Cklfsf7; Lnv; CKLF-like MARVEL transmembrane domain-containing protein 7; Chemokine-like factor superfamily member 7; LNV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cmtm7
Target Protein Sequence
MSHGSGLVRTTCSSGGALGPGQPSEGLLDRVYPLTHGALFKVAQMVTLLIAFICVRSSVP IDYGAHSFFEVVTMCDLIMILIFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASI VIASKSYNQSGLVAGAIFGFLASFLCLASLWLSYKITCITQSSDASA
Uniprot No.

Target Background

Gene References Into Functions
  1. The reduction of B-1a cells in Cmtm7(flox/) mice was associated with reduced BCR expression. PMID: 24080084
  2. CMTM7 functions to link sIgM and BLNK in the plasma membrane. PMID: 22363743
Database Links
Protein Families
Chemokine-like factor family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does CMTM7 expression vary across different tissue types?

CMTM7 shows tissue-specific expression patterns with particular relevance in immune and cancer contexts. In breast cancer, CMTM7 expression significantly correlates with molecular subtypes - showing higher expression in basal-like and normal-like PAM50 phenotypes compared to other subtypes .

Expression patterns across breast cancer subtypes:

Breast Cancer SubtypeCMTM7 Expression Level
Basal-likeHigher
Normal-likeHigher
Triple-negativeSignificantly higher
ER-positiveSignificantly lower
PR-positiveSignificantly lower
HER2-richSignificantly lower

This differential expression suggests subtype-specific roles in breast cancer biology and potential therapeutic implications .

How does CMTM7 contribute to tumor microenvironment regulation?

CMTM7 appears to have context-dependent effects on tumor microenvironment (TME). In breast cancer, CMTM7 correlates with an inflamed TME characteristic of immune-hot tumors . Patients with high CMTM7 expression (CMTM7-high group) show:

  • Higher immune scores

  • Higher stromal scores

  • Higher ESTIMATE scores

  • Lower tumor purity

Functional enrichment analysis revealed that genes upregulated in the CMTM7-high group are highly related to immune-associated signaling pathways, including T-cell activation and cytokine-cytokine receptor interaction .

Conversely, in hepatocellular carcinoma (HCC), CMTM7 appears to promote chronic inflammation, immunosuppression, M2 macrophage infiltration, and is associated with diminished response to immunotherapy .

What is the relationship between CMTM7 and cancer immunotherapy response?

CMTM7 serves as a potential predictive biomarker for immunotherapy response, but its effect appears cancer-type dependent:

  • In breast cancer: Patients with high CMTM7 expression show increased sensitivity to immunotherapy. Notably, the therapeutic predictive value of CMTM7 appears higher than established checkpoints like PD-1 and PD-L1 .

  • In hepatocellular carcinoma: CMTM7 is associated with immunosuppression, M2 macrophage infiltration, and diminished response to cancer immunotherapy . In this context, CMTM7 may represent a novel immune checkpoint for patients experiencing suboptimal therapeutic outcomes.

This contradictory role highlights the complexity of CMTM7's function across different cancer types and emphasizes the need for cancer-specific investigation .

How does CMTM7 interact with other immune checkpoints?

CMTM7 has established relationships with other immune checkpoint molecules. Most notably:

  • PD-L1 regulation: CMTM7 can influence PD-L1 expression in tumor cells. While CMTM6 is known to maintain PD-L1 expression and enhance its ability to inhibit T cells, dual knockdown of CMTM6 and CMTM7 shows more significant downregulation of PD-L1 in breast cancer cell lines compared to single knockdown of CMTM6 .

  • T-cell exhaustion: In hepatocellular carcinoma, CMTM7 is associated with T-cell exhaustion and highly plastic stem-like characteristics .

These interactions suggest that CMTM7 functions within a complex network of immunomodulatory proteins that collectively regulate anti-tumor immunity.

What techniques are recommended for analyzing CMTM7 expression in tumor samples?

Several methodological approaches can be employed to analyze CMTM7 expression:

  • Transcriptional profiling:

    • RNA sequencing

    • WGCNA (Weighted Gene Co-expression Network Analysis) to identify genes co-expressed with CMTM7

    • Analysis of the top 25% most variant genes (using analysis of variance)

  • Patient classification systems:

    • Consensus clustering with the "ConsensusClusterPlus" package in R

    • Silhouette analysis to determine optimal number of stable groups

    • Classification validation using nearest shrunken centroids method ("pamr" package)

  • Differential expression analysis:

    • Using "limma" package in R with fold-change thresholds (≥ 1.5) and adjusted p-values (< 0.05)

  • Functional validation:

    • Single-cell RNA sequencing to assess cell-type specific expression

    • Multiple fluorescence staining to visualize CMTM7 in tissue context

What are the optimal conditions for working with recombinant mouse CMTM7 protein?

When working with recombinant mouse CMTM7 protein:

  • Storage conditions:

    • Store at -20°C for short-term storage

    • For extended storage, conserve at -20°C or -80°C

    • Avoid repeated freezing and thawing

    • Working aliquots can be stored at 4°C for up to one week

  • Buffer considerations:

    • Typically stored in Tris-based buffer with 50% glycerol

    • Buffer optimization is specific to each protein preparation

  • Expression regions:

    • Full-length protein spans amino acids 1-167

    • For functional studies, specific isoforms may be more potent (e.g., for CXCL7, the Ile48-Ile109 isoform has been shown to be 200-fold more potent than the Lys40-Tyr113 isoform in certain assays)

How can researchers assess CMTM7's impact on immune cell function?

To evaluate CMTM7's effect on immune cells:

  • Immune cell infiltration analysis:

    • Single-sample gene set enrichment analysis (ssGSEA) in the R package "GSVA" to estimate infiltration levels of different immune cell populations

    • Assessment of activities of immune-related pathways using signature gene sets for 29 immune cell types

  • Macrophage phenotyping:

    • CMTM7 serves as a molecular marker for M2 macrophages in some contexts

    • Multiple fluorescence staining can be used to co-localize CMTM7 with other M2 markers

  • T-cell functionality assays:

    • Assessment of T-cell exhaustion markers in relation to CMTM7 expression

    • Analysis of T-cell activation pathways via functional enrichment analysis

How can CMTM7 be utilized as a biomarker for personalized cancer therapy?

CMTM7 shows promise as a biomarker for treatment stratification:

What are the current challenges in developing therapeutic approaches targeting CMTM7?

Several challenges exist in targeting CMTM7 therapeutically:

  • Context-dependent function:

    • CMTM7 shows opposing effects in different cancer types (beneficial in breast cancer, potentially detrimental in HCC)

    • Therapeutic strategies would need to be cancer-type specific

  • Mechanistic understanding:

    • Complete molecular mechanisms of CMTM7 function remain to be elucidated

    • Downstream effectors and signaling pathways require further characterization

  • Potential therapeutic compounds:

    • Predicted compounds like fasudil and arachidonyltrifluoromethane require validation as CMTM7 targeting agents

    • Drug development pipeline for CMTM7-specific modulators is in early stages

  • Biomarker validation:

    • Standardized methods for CMTM7 assessment in clinical settings need development

    • Threshold values for "high" versus "low" expression require validation across patient populations

What are the unexplored aspects of CMTM7 biology that warrant investigation?

Several aspects of CMTM7 biology remain to be fully understood:

  • Structural biology:

    • Detailed structural characterization of CMTM7 and its interaction domains

    • Structure-function relationships that determine context-specific activities

  • Signaling networks:

    • Complete mapping of CMTM7-associated signaling pathways

    • Interaction with the EGFR/Akt signaling pathway has been noted in breast cancer , but other pathways may be relevant in different contexts

  • Immune regulation mechanisms:

    • Molecular basis for CMTM7's role in T-cell exhaustion

    • Mechanisms underlying CMTM7's association with M2 macrophage polarization

    • Interactions with cytokine networks beyond currently established relationships

  • Therapeutic targeting:

    • Development of specific CMTM7 modulators

    • Potential synergies with existing immunotherapeutic approaches

    • Identification of patient populations most likely to benefit from CMTM7-targeted therapy

Understanding these aspects will advance both basic science knowledge and potential clinical applications of CMTM7-centered approaches in cancer treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.