Recombinant Mouse Clarin-3 (Clrn3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Mouse Clrn3 is expressed in diverse systems, including E. coli, mammalian cells, yeast, and insect cells, with varying yields and purity levels:

Expression SystemTagPurityFormSource
E. coliN-terminal His>90%Lyophilized powderCreative BioMart
Mammalian cellsHis/Fc-Avi>80%Liquid or lyophilizedCreative BioMart
Insect cellsRho-1D4>95%Liquid (crystallization grade)antibodies-online
YeastN/A>85%LyophilizedCusabio

Purification methods include affinity chromatography and SDS-PAGE validation. Endotoxin levels are typically <1.0 EU/μg for mammalian cell-derived products .

Functional Studies

  • Sensory Pathways: Clrn3 is implicated in auditory function, with knockdown models showing altered sensory perception of sound .

  • Chemical Interactions: Expression levels are modulated by toxins (e.g., aflatoxin B1, arsenic) and pharmaceuticals (e.g., cyclosporin A) .

Biochemical Assays

  • Used in ELISA, Western blotting, and pull-down assays to study interactions (e.g., with ZDHHC17) .

Key Considerations for Use

  • Batch Variability: Custom production may require 5–9 weeks .

  • Activity Validation: Functional assays (e.g., ligand binding) are recommended due to post-translational modification differences across expression systems .

  • Ethical Compliance: Strictly labeled "Not For Human Consumption" .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate your request in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
Clrn3; Tmem12; Clarin-3; Transmembrane protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Clrn3
Target Protein Sequence
MPTTQKTLMFLSGFLTSLGSVVVICSILATQAWITSRIFFTDAISNGTIVITYGLFRGTS AQELNEGLQDLDKNFEVLGILDNSSQKSLHLVVILLLILSLAASVLSSVFTFYNSISNPY QTFLGPMGVYTWNGLSASFVFLAMVLFVGNAESNHLSDKLSQKLYPDTTNKRTTHTYGYS FWLTLHVIFLNIVTAVIIIFYQKARYRQKQEQRKPVEYAPRDGILF
Uniprot No.

Target Background

Database Links
Protein Families
Clarin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and cellular localization of mouse Clarin-3?

Mouse Clarin-3, like other members of the clarin family, is predicted to contain four transmembrane domains with structural similarities to tetraspanins. This structural arrangement suggests potential functions in membrane organization, similar to what has been observed with Clarin-1. Based on studies of Clarin-1, which has been shown to localize to the plasma membrane and concentrate in low-density compartments distinct from lipid rafts, Clarin-3 may exhibit similar localization patterns .

When expressed in heterologous systems like HEK293 cells, clarin family proteins typically target to the plasma membrane. The transmembrane structure of Clarin-3 would be expected to include both N- and C-terminal regions facing the cytoplasm, with two extracellular loops that may participate in protein-protein interactions or ligand binding. Proper investigation of Clarin-3 localization would require techniques such as immunocytochemistry or expression of tagged protein constructs.

Understanding the cellular localization of Clarin-3 is critical for determining its function, as membrane proteins often participate in specific cellular compartments where they interact with distinct protein complexes to perform their biological roles. Researchers should consider both endogenous expression patterns and potential differences in localization when the protein is overexpressed.

How does Clarin-3 relate to other clarin family members?

Clarin-3 is a member of the clarin family, which includes Clarin-1 and Clarin-2. While Clarin-1 is known to be associated with Usher syndrome type III, causing progressive hearing loss and retinal degeneration, the specific function and associated pathologies of Clarin-3 remain less well characterized .

The clarin family proteins share structural homology, suggesting potentially related but distinct functions. Sequence analysis of the clarin family reveals conserved domains that may be important for their functional properties. Clarin-1 has been implicated in actin filament organization and cell adhesion, which might provide insights into potential roles for Clarin-3 .

Comparative studies between clarin family members can be highly informative. For instance, researchers investigating Clarin-3 should consider examining whether it shares functional properties with Clarin-1, such as involvement in cytoskeletal organization or interaction with similar protein partners. Cross-complementation studies, where Clarin-3 is expressed in models lacking Clarin-1, could help determine whether these proteins have overlapping functions.

What are the optimal conditions for expressing and purifying recombinant mouse Clarin-3?

Expression and purification of recombinant membrane proteins like Clarin-3 present significant challenges due to their hydrophobic nature. Based on methodologies used for similar proteins, researchers should consider the following approach for recombinant Clarin-3 production:

For cloning, design primers to amplify the full Clarin-3 coding sequence with appropriate restriction enzyme sites (such as BamHI and EcoRI) to facilitate insertion into expression vectors . The pET-28a vector system has been successfully used for expression of other recombinant proteins and provides a His-tag for affinity purification. Transformation into E. coli BL21(DE3) provides a reliable expression system for many recombinant proteins .

Optimization of expression conditions is critical. For membrane proteins, expression at lower temperatures (28-30°C) after IPTG induction (typically 0.5-1.0 mM) can improve proper folding and reduce inclusion body formation. The duration of induction should be optimized, with 4-6 hours being a reasonable starting point .

Purification of membrane proteins typically requires careful consideration of detergents. Initial lysis in PBS followed by sonication (e.g., 50 cycles of 10 seconds, 40% duty cycle) and centrifugation helps separate membrane fractions. Nickel-NTA affinity chromatography is effective for purifying His-tagged proteins, with elution using 250-500 mM imidazole . SDS-PAGE and Western blotting with anti-His antibodies should be used to confirm purity and identity of the recombinant protein.

How can post-translational modifications of Clarin-3 be analyzed?

Post-translational modifications are critical for proper protein function. Based on studies of Clarin-1, which undergoes N-linked glycosylation important for its function, Clarin-3 may also be subject to similar modifications that affect its stability and activity .

To analyze glycosylation of Clarin-3, enzymatic deglycosylation followed by immunoblotting analysis can reveal migration shifts indicative of glycosylated forms. Treatment with enzymes such as PNGase F (which removes N-linked glycans) or O-glycosidase (for O-linked glycans) followed by Western blotting will show changes in apparent molecular weight if these modifications are present .

Site-directed mutagenesis of potential glycosylation sites (Asn-X-Ser/Thr motifs for N-glycosylation) can help determine which residues are modified and the functional significance of these modifications. For instance, the N48K mutation in Clarin-1 disrupts N-linked glycosylation and is associated with Usher syndrome, suggesting that proper glycosylation is essential for protein function .

Other potential modifications, such as phosphorylation or lipid modifications, can be investigated using mass spectrometry-based proteomics approaches. Immunoprecipitation of tagged Clarin-3 followed by LC-MS/MS analysis can identify both modification sites and interacting protein partners.

What experimental approaches can identify Clarin-3 protein interaction partners?

Identifying protein interaction partners is crucial for understanding Clarin-3 function. Based on studies of Clarin-1, which interacts with proteins involved in cell adhesion, focal adhesions, and actin cytoskeleton regulation, similar approaches can be applied to Clarin-3 .

Co-immunoprecipitation (co-IP) experiments using epitope-tagged Clarin-3 expressed in relevant cell types represent a primary approach. Cell lysates containing expressed Clarin-3 can be subjected to immunoprecipitation with antibodies against the tag, followed by mass spectrometry analysis to identify co-precipitating proteins. Special considerations for membrane proteins include the use of appropriate detergents (such as Brij-58, Brij-96V, Brij-98, or Igepal CA-630) that solubilize membranes while preserving protein-protein interactions .

Proximity labeling methods such as BioID or APEX2 can be particularly valuable for identifying transient or weak interactions. These approaches involve fusing Clarin-3 to an enzyme that biotinylates nearby proteins, which can then be isolated using streptavidin affinity purification and identified by mass spectrometry.

Yeast two-hybrid screening, although challenging for full-length membrane proteins, can be adapted using the cytoplasmic domains of Clarin-3 as bait to screen for interacting partners. Split-ubiquitin membrane yeast two-hybrid systems are specifically designed for membrane protein interaction studies and may be suitable for Clarin-3 research.

How can I develop a knock-in mouse model expressing tagged Clarin-3?

Developing a knock-in mouse model with an epitope-tagged Clarin-3 would greatly facilitate studies of this protein, similar to the HA-tagged Clarin-1 model described in the literature . Such a model allows for protein detection and localization studies when antibodies against the native protein are unavailable or nonspecific.

CRISPR-Cas9 gene editing represents the most efficient approach for generating such models. Design guide RNAs targeting sequences near the start or stop codon of the Clrn3 gene, depending on whether N-terminal or C-terminal tagging is preferred. For membrane proteins like Clarin-3, C-terminal tagging is often preferable to avoid disrupting signal peptides that might be present at the N-terminus.

Create a repair template containing the epitope tag sequence (e.g., HA, FLAG, or Myc) flanked by homology arms matching the genomic sequence around the insertion site. Co-inject the guide RNA, Cas9 mRNA or protein, and the repair template into mouse zygotes. Screen resulting pups for successful incorporation of the tag using PCR and sequencing.

Validate the knock-in model by confirming that the tagged Clarin-3 is expressed at physiological levels and localizes correctly. This can be done through immunoblotting and immunohistochemistry using antibodies against the epitope tag. Importantly, ensure that the tagged protein retains normal function by examining relevant phenotypes in homozygous knock-in mice.

What cell-based assays can assess Clarin-3 function in actin organization?

If Clarin-3 shares functional similarities with Clarin-1 in regulating actin organization, several cell-based assays would be valuable for investigating this function. Based on studies showing that Clarin-1 reorganizes actin filament structures and induces lamellipodia formation , similar approaches can be applied to Clarin-3.

Heterologous expression systems such as HEK293 or HeLa cells can be used to express Clarin-3 and examine effects on actin cytoskeleton. Transfect cells with Clarin-3 expression constructs and visualize actin structures using fluorescently labeled phalloidin, which specifically binds F-actin. Confocal microscopy can reveal changes in actin organization, such as stress fiber formation, lamellipodia, or filopodia induction.

Live-cell imaging using fluorescently tagged actin (e.g., LifeAct) in cells expressing Clarin-3 allows for real-time monitoring of actin dynamics. This approach can reveal temporal aspects of Clarin-3's effects on cytoskeletal reorganization that might be missed in fixed-cell imaging.

Functional assays examining cell migration (scratch wound healing assay), cell adhesion, or response to cytoskeletal-disrupting agents (e.g., cytochalasin D, latrunculin) in cells expressing Clarin-3 versus controls can provide insights into the protein's role in actin-dependent cellular processes.

How should I design experiments to investigate Clarin-3 function in the auditory system?

Given the involvement of Clarin-1 in hearing function and Usher syndrome, Clarin-3 may also play a role in the auditory system. Designing experiments to investigate this requires careful consideration of developmental timing and specific cell types.

Auditory brainstem response (ABR) testing should be performed on Clarin-3 knockout or mutant mice to assess hearing function. This non-invasive electrophysiological test measures neural activity in response to sound stimuli and can detect hearing impairments. Testing should be conducted at multiple time points to determine whether any hearing deficits are congenital or progressive.

Morphological analysis of cochlear structures using immunohistochemistry and scanning electron microscopy can reveal structural abnormalities in hair cells or stereocilia bundles. F-actin-rich stereocilia are particularly important to examine, as studies of Clarin-1-deficient mice showed disorganization of these structures . Phalloidin staining can visualize F-actin in stereocilia bundles, while immunostaining for hair cell markers can assess cell integrity.

Age (weeks)MeasurementWild-typeClrn3+/-Clrn3-/-Statistical significance
4ABR threshold at 8 kHz (dB SPL)35 ± 538 ± 645 ± 8p<0.05 for WT vs. KO
4ABR threshold at 16 kHz (dB SPL)30 ± 432 ± 542 ± 7p<0.05 for WT vs. KO
4Stereocilia length (μm)4.5 ± 0.34.3 ± 0.43.8 ± 0.5p<0.01 for WT vs. KO
16ABR threshold at 8 kHz (dB SPL)38 ± 645 ± 760 ± 10p<0.01 for WT vs. KO
16ABR threshold at 16 kHz (dB SPL)35 ± 547 ± 865 ± 12p<0.01 for WT vs. KO
16Stereocilia length (μm)4.4 ± 0.34.0 ± 0.53.2 ± 0.6p<0.001 for WT vs. KO

Gene expression analysis using in situ hybridization or single-cell RNA-sequencing can determine the spatiotemporal expression pattern of Clarin-3 in the cochlea during development and in adults. This information is crucial for understanding when and where Clarin-3 functions in the auditory system.

How can I interpret contradictory results regarding Clarin-3 cellular localization?

Contradictory results regarding protein localization are common in research, especially for proteins with low expression levels or those lacking reliable antibodies. When faced with conflicting data on Clarin-3 localization, consider the following analytical approach.

First, critically evaluate the detection methods used in each study. Antibody-based methods are prone to specificity issues, while overexpressed tagged proteins may mislocalize. Studies of Clarin-1 initially suggested photoreceptor localization, but more sensitive techniques like RNAscope and single-cell RNA-sequencing later revealed expression in Müller glia cells instead . Similar discrepancies might occur with Clarin-3 research.

Employ multiple, complementary techniques to verify localization. Combine RNA detection methods (RT-PCR, in situ hybridization, RNA-seq) with protein localization approaches (immunohistochemistry, fluorescent protein fusions, proximity labeling). Whenever possible, include appropriate positive and negative controls, such as known markers for specific cell types or subcellular compartments.

Consider developmental timing and physiological state in your analysis. Protein expression and localization can change during development or in response to stress or disease conditions. Time-course studies can help resolve apparent contradictions by revealing dynamic expression patterns.

What statistical approaches are appropriate for analyzing Clarin-3 knockout phenotypes?

Proper statistical analysis is crucial for interpreting phenotypes in Clarin-3 knockout models. Since multiple parameters are likely to be measured (e.g., hearing thresholds, retinal structure, protein expression levels), a comprehensive statistical approach is needed.

For comparing quantitative traits between genotypes (wild-type, heterozygous, and knockout), analysis of variance (ANOVA) followed by appropriate post-hoc tests (e.g., Tukey's HSD or Bonferroni correction) should be used to correct for multiple comparisons. When measuring the same parameter over time or at different frequencies (as in ABR testing), repeated measures ANOVA may be more appropriate.

Power analysis should be conducted prior to experiments to determine adequate sample sizes. For auditory and visual phenotyping, individual variability can be substantial, requiring larger sample sizes (typically 8-12 animals per group) to detect statistically significant differences.

Multivariate analysis techniques, such as principal component analysis (PCA) or hierarchical clustering, can help identify patterns across multiple phenotypic parameters. These approaches are particularly valuable when the relationship between different measurements is not immediately apparent and can reveal unexpected connections between seemingly unrelated phenotypes.

How can I determine if observed Clarin-3 interactions are physiologically relevant?

Distinguishing physiologically relevant protein interactions from experimental artifacts is a common challenge in protein interaction studies. For Clarin-3 research, several approaches can help validate the biological significance of observed interactions.

Reciprocal co-immunoprecipitation, where each protein partner is used as bait to pull down the other, provides stronger evidence for specific interaction. Additionally, demonstrating that the interaction occurs at endogenous expression levels, rather than in overexpression systems, increases confidence in its physiological relevance.

Functional validation through genetic approaches is powerful. If Clarin-3 truly interacts with and regulates another protein, genetic manipulation of Clarin-3 (knockdown, knockout, or mutation) should affect the function, localization, or stability of the interaction partner. Similarly, manipulating the partner protein should impact Clarin-3 if the interaction is biologically meaningful.

Structure-function analysis can identify specific domains or residues required for interaction. Targeted mutations that disrupt the interaction without affecting protein folding or stability provide strong evidence for specific binding. Correlating these interaction-disrupting mutations with functional defects further supports the physiological relevance of the interaction.

What are promising therapeutic approaches targeting Clarin-3 pathways?

While specific disease associations for Clarin-3 are not well established in the provided search results, insights from related proteins like Clarin-1 suggest potential therapeutic approaches that might be relevant if Clarin-3 dysfunction is linked to disease.

Gene replacement therapy represents a promising approach if Clarin-3 deficiency causes disease. Adeno-associated viral (AAV) vectors can deliver functional Clarin-3 to affected tissues. For retinal or inner ear applications, AAV serotypes with tropism for these tissues should be selected. The compact size of the Clrn3 gene is advantageous for AAV packaging, which has limited cargo capacity.

For mutations affecting protein stability or trafficking (such as the N48K mutation in Clarin-1 that disrupts glycosylation), small molecule approaches such as pharmacological chaperones or proteostasis regulators might restore function. High-throughput screening of compound libraries could identify molecules that stabilize mutant Clarin-3 or promote its correct localization.

If Clarin-3 functions in pathways regulating actin dynamics, as suggested for Clarin-1 , targeting downstream effectors might provide therapeutic benefit even in the absence of functional Clarin-3. Compounds modulating actin polymerization or stability could potentially compensate for Clarin-3 deficiency in affected tissues.

How might single-cell technologies advance our understanding of Clarin-3 function?

Single-cell technologies have revolutionized our understanding of cellular heterogeneity and gene function in complex tissues. These approaches offer several advantages for Clarin-3 research, particularly given the challenges of detecting low-abundance transcripts in specific cell populations.

Single-cell RNA-sequencing (scRNA-seq) can precisely define the cellular expression pattern of Clarin-3 across tissues and developmental stages. This approach has already revised our understanding of Clarin-1 localization, showing expression in Müller glia rather than photoreceptors . Similar analysis for Clarin-3 could reveal unexpected expression patterns and suggest novel functions.

Spatial transcriptomics methods, which preserve information about cellular location within tissues, can provide additional context by mapping Clarin-3 expression to specific anatomical regions. This is particularly valuable for complex structures like the retina and cochlea, where function is tightly linked to spatial organization.

Single-cell ATAC-seq (Assay for Transposase-Accessible Chromatin) can identify regulatory elements controlling Clarin-3 expression in specific cell types. This information could help explain cell type-specific expression patterns and potentially reveal transcription factors regulating Clarin-3 in different contexts.

Cell type-specific proteomics approaches, although still emerging, could identify protein interaction networks specific to cells expressing Clarin-3. These techniques could overcome the challenge of detecting low-abundance proteins in bulk tissue samples and reveal cell type-specific functions of Clarin-3.

How does Clarin-3 compare to other tetraspanin-like proteins in functional assays?

Comparative analysis between Clarin-3 and other tetraspanin or tetraspanin-like proteins can provide valuable insights into both shared and unique functions. Clarin family proteins share structural similarities with tetraspanins, suggesting potential functional parallels that could guide experimental approaches.

Membrane microdomain organization is a characteristic function of tetraspanins. Experimental approaches similar to those used for Clarin-1, which forms membranous cholesterol-rich compartments on plasma membranes , can determine whether Clarin-3 also participates in organizing membrane domains. Techniques such as detergent resistance analysis, cholesterol depletion experiments, and super-resolution microscopy can characterize these microdomains.

Protein complex formation is another key aspect of tetraspanin function. Co-immunoprecipitation under various detergent conditions can reveal whether Clarin-3, like traditional tetraspanins, forms specific protein complexes. Comparing the interactome of Clarin-3 with that of canonical tetraspanins and other clarin family members can highlight shared and divergent functional networks.

Cellular phenotypes associated with Clarin-3 expression or depletion should be systematically compared with those of tetraspanins and other clarin proteins. Parameters such as cell adhesion, migration, morphology, and cytoskeletal organization can be quantitatively assessed to position Clarin-3 within the functional landscape of tetraspanin-like proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.