Recombinant Mouse Claudin-12 (Cldn12)

What is the basic structure and characteristics of recombinant mouse Claudin-12?

Recombinant full-length mouse Claudin-12 (Cldn12) is a 244 amino acid protein with the UniProt ID Q9ET43. The complete sequence is: MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTIYTGLWVKCAR YDGSSDCLMYDRTWYLSVDQLDLRVLQFALPLSIVIAMGALLLCLIGMCNTAFNSSVPNI KLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWAIFYNSHLNRKFEPVFTFDYAVFVTIA SSGGLFMTALLLFVWYCACKSLSSPFWQPLYSHAPGMHTYSQPYSSRSRLSAIEIDIPVV SHST . As a tight junction protein, it typically contains four transmembrane domains with two extracellular loops that are crucial for its barrier function and interaction with other molecules.

How should recombinant mouse Claudin-12 be stored and handled for optimal stability?

Recombinant mouse Claudin-12 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles. For reconstitution, briefly centrifuge the vial before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage at -20°C/-80°C . For working aliquots, storage at 4°C for up to one week is acceptable, but repeated freezing and thawing should be avoided to maintain protein integrity .

What detection methods are most effective for monitoring Claudin-12 expression in cell and tissue samples?

Several effective detection methods can be employed for monitoring Claudin-12 expression:

Immunofluorescence: Fixed cells can be stained with anti-Claudin-12 antibodies followed by fluorophore-conjugated secondary antibodies. This approach has been successfully used in studies where cells were fixed with cold acetone:methanol (1:1), incubated with anti-CLDN12 antibody, and visualized using FITC-conjugated secondary antibodies . For transfected cell lines, Claudin-12 has been detected using 10 μg/mL anti-Claudin-12 monoclonal antibody for 3 hours at room temperature, followed by fluorophore-conjugated secondary antibodies and DAPI counterstaining .

Flow Cytometry: Cell lines expressing Claudin-12 can be analyzed by flow cytometry, as demonstrated with Caco-2 human colorectal adenocarcinoma cells using anti-human Claudin-12 monoclonal antibody and phycoerythrin-conjugated secondary antibodies .

X-gal Staining: For Claudin-12 knockout models where β-galactosidase replaces the Claudin-12 coding exon, X-gal staining can effectively identify tissues with Claudin-12 promoter activity .

How can researchers assess the functional role of Claudin-12 in tight junction barrier formation?

To assess Claudin-12's functional role in tight junction barrier formation, researchers can employ these methodological approaches:

Transwell Migration Assays: Using Transwell systems with 8.0 μm pore polycarbonate membranes, researchers can establish cell monolayers, treat them with anti-Claudin-12 antibodies (1 μg/mL), and measure changes in barrier integrity or cell migration through the barrier . This approach can determine whether Claudin-12 blocking affects tight junction function.

Competitive Inhibition with Synthetic Peptides: Synthetic peptides (5 μg/mL) representing the extracellular loops of Claudin-12 can be used to competitively inhibit Claudin-12 function in tight junctions. Co-cultures in Transwell systems with these peptides can reveal whether disrupting Claudin-12 interactions affects barrier function or cell migration .

Ex Vivo Tubule Perfusion: For tissue-specific studies, ex vivo perfusion of isolated proximal tubules can measure paracellular permeability. This technique has successfully demonstrated reduced calcium permeability in proximal tubules from Claudin-12 knockout mice compared to wild-type mice .

What are the methodological considerations when performing cell migration assays involving Claudin-12?

When performing cell migration assays involving Claudin-12, researchers should consider these methodological factors:

• Cell Selection: Choose appropriate Claudin-12 positive and negative cell lines as controls. Previous studies have identified A549 and LS180 as Claudin-12 positive cell lines and HeLa as Claudin-12 negative .

• Experimental Setup: Use Transwell chambers with appropriate pore sizes (8.0 μm for adherent cell migration, 3.0 μm for immune cell migration through formed monolayers) .

• Treatment Timing: For antibody blocking experiments, treat cell monolayers with anti-Claudin-12 antibody (1 μg/mL) for 30 minutes at 37°C, followed by washing steps before the migration period .

• Quantification Methods: After migration, fix cells with cold methanol, stain with 0.5% crystal violet for 10 minutes, and count cells under an inverted light microscope. Multiple fields should be counted and averaged for statistical significance .

• Viability Controls: Perform MTT assays in parallel to ensure treatments don't affect cell viability rather than migration specifically. Add MTT solution (5 mg/mL) for 3 hours at the end of the experiment, followed by DMSO solubilization and absorbance measurement at 540 nm .

What are the main phenotypic characteristics of Claudin-12 knockout mice?

Claudin-12 knockout (Cldn12-KO) mice display several distinct phenotypic characteristics that vary by sex and tissue system:

Nerve Barrier Alterations: Male Cldn12-KO mice exhibit perineurial and myelin barrier breakdown, with increased barrier leakage and damaged tight junction protein expression and morphology .

Pain Sensitivity: These mice show increased mechanical hypersensitivity in both naïve and neuropathic conditions, suggesting Claudin-12's role in pain regulation pathways .

Inflammatory Changes: Increased proinflammatory cytokines are observed in male knockout mice .

Sex-Specific Effects: Remarkably, fertile female mice appear completely protected from these phenotypic changes, indicating important sex-specific mechanisms in Claudin-12 function .

Renal Function: Despite showing reduced proximal tubule calcium permeability, Cldn12-KO mice do not display differences in urinary calcium excretion compared to wild-type littermates, suggesting compensatory mechanisms .

Normal Growth and Behavior: Despite these specific alterations, Cldn12-KO mice grow and behave similarly to their wild-type littermates and do not show differences in plasma electrolytes or calciotropic hormone levels .

How are Claudin-12 knockout mice generated and validated?

Generation of Claudin-12 knockout mice involves several methodological steps:

Embryonic Stem Cell Modification: Chimeras with Cldn12 gene ablation are first generated by transferring murine embryonic stem cell clones (such as clone 13208A from VelociGene) into blastocysts from albino-C57BL/6J mice .

Gene Replacement Strategy: The single coding exon of Claudin-12 is typically replaced with a reporter gene such as β-galactosidase from E. coli, which allows for expression tracking using X-gal staining .

Validation Methods:

• Genotyping to confirm gene deletion

• X-gal staining to verify the expression pattern of the reporter gene under the Claudin-12 promoter

• Colocalization studies with known markers (e.g., aquaporin-1 for proximal tubule expression)

• Functional assays, such as ex vivo tubule perfusion, to confirm altered permeability

• Confirming absence of Claudin-12 protein expression using antibody-based methods

What compensatory mechanisms occur in Claudin-12 knockout mice?

Claudin-12 knockout mice exhibit several compensatory mechanisms that may explain the absence of certain expected phenotypes:

Renal Compensation: Despite reduced proximal tubule calcium permeability, Cldn12-KO mice do not show increased urinary calcium excretion. This is likely due to downstream compensation via reduced expression of claudin-14 in the thick ascending limb (TAL) . Claudin-14 normally blocks calcium permeability in the TAL, so its downregulation could increase calcium reabsorption in this segment, compensating for decreased proximal tubule reabsorption .

Barrier Specificity: While perineurial and myelin barriers are affected in Cldn12-KO mice, other barriers, including the blood-brain barrier (BBB), remain intact . This suggests that other claudins or tight junction proteins may be compensating for Claudin-12's absence in specific barrier types.

SHH Pathway Involvement: Knockout studies have revealed a significant reduction of the morphogen and barrier stabilizer Sonic Hedgehog (SHH) in Cldn12-KO mice, which may explain observed tight junction protein disruption . This suggests a regulatory relationship between Claudin-12 and the SHH pathway that could be targeted for therapeutic interventions.

What is the role of Claudin-12 in calcium transport across epithelial barriers?

Claudin-12 plays a significant role in calcium transport across epithelial barriers, particularly in the kidney and intestine:

Proximal Tubule Calcium Permeability: Ex vivo perfusion studies of proximal tubules from Claudin-12 knockout mice demonstrate significantly reduced paracellular calcium permeability compared to wild-type mice . This confirms Claudin-12's contribution to the calcium-permeable paracellular pathway in this nephron segment.

Coexpression with Other Calcium-Permeable Claudins: Claudin-12 and Claudin-2 are both expressed in the intestine and proximal tubule, where they are implicated in mediating calcium permeability . This suggests a coordinated system of claudins regulating calcium transport.

Tissue-Specific Expression: X-gal staining in Claudin-12 reporter mice reveals predominant expression in the renal cortex colocalizing with aquaporin-1, confirming its proximal tubule localization where approximately 60-70% of filtered calcium is reabsorbed .

Compensatory Mechanisms: Despite its role in calcium permeability, the absence of Claudin-12 does not lead to increased urinary calcium excretion, suggesting effective compensation through other channels or transporters, particularly reduced claudin-14 expression in the thick ascending limb .

How does Claudin-12 interact with other tight junction proteins?

Claudin-12 displays unique interaction characteristics with other tight junction proteins:

Limited Direct Interactions: In vitro transfection studies have documented that claudin-12 localizes to the plasma membrane but does not appear to interact directly with other tight junction proteins . This suggests Claudin-12 may function independently within the tight junction complex.

Regulatory Function: Rather than having intrinsic sealing properties, Claudin-12 appears to serve a regulatory function on other tight junction proteins, particularly in the myelin barrier via the morphogen Sonic Hedgehog (SHH) .

Effect on Other Claudins: Claudin-12 deficiency results in downregulation of certain other tight junction proteins , suggesting it may stabilize or promote the expression of other claudins despite limited direct protein-protein interactions.

Barrier-Specific Effects: Claudin-12's interactions appear to be barrier-specific, affecting perineurial and myelin barriers but not the blood-brain barrier , indicating context-dependent interaction patterns with other junction components.

What is the connection between Claudin-12 and Sonic Hedgehog (SHH) signaling?

The connection between Claudin-12 and Sonic Hedgehog (SHH) signaling represents an important regulatory pathway:

Reduced SHH in Knockout Models: Cldn12-KO mice show a significant reduction of the morphogen SHH . This reduction could explain the observed tight junction protein disruption in these mice.

Regulatory Relationship: Rather than functioning primarily as a barrier-forming tight junction protein, Claudin-12 appears to have a regulatory role on the myelin barrier via the SHH pathway .

Therapeutic Target Potential: The claudin-12/SHH pathway has been highlighted as a potential target for treating painful neuropathy , suggesting clinical relevance of this interaction.

Mechanistic Pathway: While the exact molecular mechanisms linking Claudin-12 to SHH signaling remain to be fully elucidated, this connection suggests Claudin-12 may participate in developmental and homeostatic signaling pathways beyond its structural role in tight junctions.

How can researchers effectively use the claudin-12/SHH pathway as a target for neuropathic pain interventions?

Targeting the claudin-12/SHH pathway for neuropathic pain interventions requires several strategic approaches:

Pathway Validation: First confirm the relationship between claudin-12 deficiency, SHH reduction, and mechanical hypersensitivity through both genetic models (Cldn12-KO) and local siRNA knockdown approaches . This validates the pathway as a legitimate target.

Sex-Specific Considerations: Research designs must account for the striking sexual dimorphism observed in Cldn12-KO phenotypes, where fertile female mice are completely protected from the nerve barrier breakdown and pain hypersensitivity seen in males . Understanding this protection mechanism could reveal natural protective factors that might be therapeutically leveraged.

Local Delivery Strategies: Develop local delivery methods for SHH pathway activators or claudin-12 mimetics that can restore barrier function specifically at nerve barriers without systemic effects. This could include:

• Targeted nanoparticle delivery systems

• Hydrogel-based sustained release formulations

• Cell-penetrating peptides conjugated to SHH pathway modulators

Combination Approaches: Test combinations of anti-inflammatory agents with SHH pathway activators, since Cldn12-KO mice show increased proinflammatory cytokines alongside barrier breakdown .

Biomarker Development: Establish circulating or imaging biomarkers that correlate with nerve barrier integrity to monitor treatment efficacy in both preclinical and clinical settings.

What experimental approaches can identify novel binding partners of Claudin-12?

To identify novel binding partners of Claudin-12, researchers can employ these advanced experimental approaches:

Proximity Labeling Techniques:

• BioID or TurboID fusion proteins with Claudin-12 that biotinylate proximal proteins

• APEX2-mediated proximity labeling in living cells

• These approaches allow for identification of both stable and transient interactions in the native cellular environment

Crosslinking Mass Spectrometry (XL-MS):

• Chemical crosslinking of proteins in their native state

• Digestion and mass spectrometry analysis

• Computational identification of crosslinked peptides to map interaction interfaces

Co-Immunoprecipitation with Quantitative Proteomics:

• Immunoprecipitation of Claudin-12 followed by mass spectrometry

• SILAC or TMT labeling for quantitative comparison between samples and controls

• Analysis in multiple cell types that express Claudin-12 natively (e.g., A549, LS180)

Split-Protein Complementation Assays:

• BiFC (Bimolecular Fluorescence Complementation) with Claudin-12 fused to half of a fluorescent protein

• Screening of candidate interactors fused to the complementary half

• Live-cell visualization of protein-protein interactions

Functional Screening Using Synthetic Peptides:

• Create a library of synthetic peptides representing different regions of Claudin-12

• Use these in competition assays to disrupt specific interactions

• This approach has already been applied with peptides representing the extracellular loops of Claudin-12

How does Claudin-12 contribute to cancer cell migration and metastasis?

Claudin-12's contribution to cancer cell migration and metastasis involves several mechanisms that can be experimentally demonstrated:

Migration Enhancement: Studies using Transwell migration assays show that Claudin-12 positive cancer cell lines (like A549 and LS180) exhibit migration capabilities that can be inhibited by anti-Claudin-12 antibody treatment . This suggests Claudin-12 facilitates migration in cancer cells.

Extracellular Loop Involvement: Synthetic peptides representing parts of Claudin-12's extracellular domains can competitively inhibit cancer cell migration, indicating these domains are specifically involved in the migration process . The mechanism likely involves:

• Homophilic or heterophilic interactions with other claudins or adhesion molecules

• Potential binding to extracellular matrix components

• Possible activation of migration-promoting signaling pathways

Tight Junction Modulation: During metastasis, cancer cells must traverse epithelial barriers by crossing tight junctions. Claudin-12 may facilitate this process by modulating tight junction permeability or mediating interactions between cancer cells and barrier-forming cells .

Cell Line Specificity: Experimental evidence shows that Claudin-12's role in migration varies between cell types - highlighting the importance of characterizing Claudin-12 expression in specific cancer types when considering it as a therapeutic target .

Potential Therapeutic Approaches: Based on these findings, potential therapeutic strategies include:

• Blocking antibodies targeting Claudin-12 extracellular domains

• Competitive peptide inhibitors derived from Claudin-12 structure

• RNA interference to reduce Claudin-12 expression in metastatic cells

What are the common challenges in producing high-quality recombinant mouse Claudin-12 and how can they be overcome?

Producing high-quality recombinant mouse Claudin-12 presents several challenges:

Protein Solubility and Folding: As a membrane protein with four transmembrane domains, Claudin-12 can be difficult to express in soluble, correctly folded form.

• Solution: Optimize expression conditions in E. coli by using specialized strains designed for membrane proteins, lower induction temperatures (16-25°C), and milder induction conditions .

• Alternative: Consider fusion tags that enhance solubility (MBP, SUMO) or utilize insect or mammalian expression systems for better folding.

Purification Efficiency: Membrane proteins often require detergents for extraction and purification, which can affect yield and native conformation.

• Solution: Screen multiple detergents or detergent mixtures for optimal extraction while maintaining protein integrity. Common options include n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin.

• Quality Control: Implement size exclusion chromatography as a final purification step to ensure homogeneity and remove aggregates.

Storage Stability: Recombinant Claudin-12 stability can decline with improper storage.

• Solution: As indicated in the product information, lyophilization and storage with cryoprotectants (6% Trehalose in Tris/PBS-based buffer, pH 8.0) significantly enhances stability . Proper aliquoting prevents repeated freeze-thaw cycles.

Functional Validation: Ensuring the recombinant protein maintains native functionality can be challenging.

• Solution: Develop functional assays such as liposome incorporation studies, binding assays with known interactors, or reconstitution into artificial membranes to verify proper folding and function.

How can researchers resolve contradictory data regarding Claudin-12 expression and function?

When faced with contradictory data regarding Claudin-12 expression and function, researchers should consider these methodological approaches:

Antibody Validation: Inconsistent results may stem from antibody specificity issues.

• Solution: Validate antibodies using positive and negative control cell lines (e.g., A549 and LS180 as positive, HeLa as negative for Claudin-12) . Confirm specificity using Claudin-12 knockout tissues or knockdown cells.

• Alternative Approaches: Employ multiple detection methods including mRNA analysis, reporter gene systems, and mass spectrometry to corroborate protein expression data.

Contextual Dependencies: Claudin-12 function may be highly context-dependent.

• Solution: Carefully document experimental conditions, cell types, and tissue contexts. For example, the sex-specific effects observed in Claudin-12 knockout mice highlight the importance of reporting sex as a biological variable.

• Controlled Comparisons: Direct side-by-side experiments using standardized protocols across different models can help resolve apparent contradictions.

Compensatory Mechanisms: Contradictory phenotypes may result from compensation.

• Solution: Examine expression of other claudins or tight junction proteins when Claudin-12 is manipulated. The compensation via reduced claudin-14 expression in Claudin-12 knockout mice exemplifies how secondary changes can mask primary effects.

• Acute vs. Chronic Models: Compare acute knockdown (siRNA) with chronic knockout models to distinguish direct effects from compensated phenotypes.

Functional Redundancy: Multiple claudins can serve similar functions in different contexts.

• Solution: Design experiments with multiple claudin manipulations to assess redundancy. For instance, examine the combined roles of Claudin-2 and Claudin-12 in calcium transport since both are implicated in this function .

What cutting-edge technologies are emerging for studying claudin biology and barrier function?

Several cutting-edge technologies are transforming claudin biology research:

Organoid and Microphysiological Systems:

• Advanced 3D tissue cultures that recapitulate organ-specific barrier properties

• Organ-on-chip technologies incorporating flow dynamics and mechanical forces

• These systems allow for physiologically relevant study of claudin function in tissue-specific contexts with greater translational potential than traditional cell culture

CRISPR Gene Editing for Precise Modifications:

• Generation of tagged endogenous claudins to avoid overexpression artifacts

• Creation of conditional and inducible knockout models to study temporal aspects of claudin function

• Base editing and prime editing for introducing specific mutations to study structure-function relationships

Advanced Imaging Technologies:

• Super-resolution microscopy (STORM, PALM, STED) for nanoscale visualization of tight junction architecture

• Live-cell imaging with tagged claudins to study dynamics and trafficking

• Correlative light and electron microscopy (CLEM) to connect molecular localization with ultrastructural features

• Lattice light-sheet microscopy for long-term, low-phototoxicity imaging of barrier dynamics

Single-Cell Technologies:

• Single-cell RNA sequencing to reveal heterogeneity in claudin expression patterns

• Single-cell proteomics to capture post-translational modifications and protein complexes

• Spatial transcriptomics to map claudin expression within tissue architecture

In Situ Structural Biology:

• Cryo-electron tomography of intact tight junctions

• In-cell NMR to study structural dynamics in living cells

• Cross-linking mass spectrometry within native tissue contexts to map claudin interactions

These technological advances will enable researchers to address fundamental questions about claudin biology with unprecedented resolution and physiological relevance, potentially leading to novel therapeutic approaches targeting barrier dysfunction in disease states.