Recombinant Mouse Claudin-18 (Cldn18)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Applications

Recombinant Cldn18 is validated for biochemical and cellular assays:

Activity Assays

  • ELISA Binding: Immobilized Cldn18 (5 µg/mL) binds anti-Cldn18.2 antibodies with an EC50 of 6.115–11.01 ng/mL .

  • Western Blot: Detected via anti-His or anti-Strep-tag antibodies .

Key Applications

ApplicationDetailsSources
Western BlottingConfirms expression in cell lysates or recombinant protein preparations.
Functional StudiesAssesses barrier integrity and ion transport in epithelial models.
Targeted TherapyUsed in antibody-drug conjugate (ADC) development (e.g., BSI-706) .

Tight Junction Dynamics

Cldn18 maintains epithelial barrier integrity by regulating paracellular ion transport. Knockout models show:

  • Lung: Impaired alveolarization and increased susceptibility to lung adenocarcinoma .

  • Stomach: Paracellular H+ leak, gastritis, and accelerated gastric cancer progression .

Tumor Suppression and Oncogenic Roles

IsoformRole in CancerMechanismSources
Cldn18.1Tumor suppressor (lung)Restricts YAP1 nuclear translocation.
Cldn18.2Tumor promoter (gastric, pancreatic)Loss promotes stemness and Wnt/Notch signaling.

Cldn18.2 is highly expressed in gastric (60–80%), pancreatic (50%), and esophageal (30–50%) cancers, with minimal expression in normal tissues .

Antibody-Drug Conjugates (ADCs)

  • BSI-706: A humanized anti-Cldn18.2 antibody with superior internalization activity compared to Zolbetuximab .

  • BSI-725: A bispecific ADC targeting Cldn18.2 and TROP2, enhancing cytotoxicity in double-positive gastric cancers .

Preclinical Models

  • Cldn18 Knockout Mice: Develop spontaneous carcinomas in lung and stomach, validating its role in tumor suppression .

  • H. pylori Infection: Reduces Cldn18 expression, mimicking human gastric cancer progression .

Production and Formulation

ParameterDetailsSources
Expression SystemMammalian cells (e.g., HEK293) or cell-free synthesis (CFPS) .
PurificationHis-tag or Strep-tag affinity chromatography.
FormLyophilized powder (PBS, 6% trehalose) or liquid (with glycerol) .
VLPs PlatformVirus-like particles enhance stability and structural mimicry .

Comparative Analysis of Recombinant Cldn18 Variants

VariantTagExpression SystemKey ApplicationSources
His-tagged6xHisMammalianWB, ELISA, ADC development
Strep-taggedStrepCFPSHigh-purity purification
VLPsN/AMammalian + VLPStructural studies, vaccines

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cldn18; Claudin-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Uniprot No.

Target Background

Function
Claudin-18 plays a critical role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References Into Functions
  1. The presented data support the hypothesis that claudin-18 is a central barrier-forming component of tight junctions. The research shows that IL-13 downregulates claudin-18, suggesting a potential link between claudin-18 loss and increased sensitization to aeroantigens and airway responsiveness. PMID: 27215490
  2. Claudin-18 knockout mice exhibited decreased P2X7 mRNA transcript abundance as measured by mRNA expression microarray. PMID: 27663455
  3. CLDN18 deficiency leads to epithelial barrier dysfunction, injury, and impaired alveolarization in mice. PMID: 24787463
  4. Research highlights a role for claudin 18 in alveolar fluid homeostasis, beyond its direct contributions to barrier properties. PMID: 24588076
  5. Findings indicate that estrogen's effects on osteoclasts may be partially mediated through regulation of Cldn-18 signaling. PMID: 23299504
  6. Claudin-18 is expressed in various epithelial tissues of the inner ear, including the Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and the dark cell area. PMID: 14698084
  7. Cldn-18 acts as a novel negative regulator of bone resorption and osteoclast differentiation. PMID: 22437732
  8. Claudin-18 forms a paracellular barrier against H(+) in the stomach. Deficiency results in paracellular H(+) leak, up-regulation of proinflammatory cytokines, recruitment of neutrophils, and atrophic gastritis. PMID: 22079592
  9. Increased expression of claudin-18 is associated with ulcerative colitis. PMID: 18831034

Show More

Hide All

Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform A1.1: Expressed in lung. Isoform A1.2: Expressed in lung. Isoform A2.1: Expressed in stomach. Isoform A2.2: Expressed in stomach.

Q&A

What is the basic structure and function of Mouse Claudin-18?

Mouse Claudin-18 is a tight junction (TJ) protein consisting of 264 amino acids with a molecular weight of approximately 29.1 kDa. The protein contains transmembrane domains that allow it to integrate into cell membranes, particularly in epithelial tissues. Its primary function involves regulating paracellular permeability to ions and solutes across epithelial barriers. Claudin-18 is highly expressed in lung alveolar epithelium where it plays a crucial role in maintaining the integrity of the alveolar barrier and regulating fluid homeostasis. The protein achieves this by forming tight junction strands that seal the paracellular space between adjacent cells, thereby controlling the movement of molecules through this pathway .

How does Claudin-18 contribute to epithelial barrier function in mouse models?

Claudin-18 makes significant contributions to epithelial barrier function by regulating tight junction composition and permeability properties. Studies using Claudin-18 knockout (C18 KO) mice have demonstrated that it plays a nonredundant role in maintaining alveolar epithelial barrier integrity. When Claudin-18 is absent, mice exhibit increased solute permeability across the alveolar epithelium, indicating compromised barrier function. Interestingly, despite this increased permeability, C18 KO mice do not develop pulmonary edema because they simultaneously demonstrate increased alveolar fluid clearance (AFC), suggesting a compensatory mechanism that maintains fluid balance in the lungs . The protein also influences the expression and localization of other tight junction proteins, as evidenced by the increased expression of claudin-3 and claudin-4 in C18 KO mice .

What are the signaling pathways influenced by Claudin-18 in mouse models?

Claudin-18 influences several key signaling pathways in mice:

  • β-adrenergic receptor signaling: Claudin-18 regulates this pathway, with its absence leading to increased signaling activity that enhances alveolar fluid clearance via activation of downstream ion channels and transporters .

  • Actin cytoskeleton organization: Claudin-18 affects the organization of the actin cytoskeleton, with knockout studies showing cytoskeletal rearrangements in alveolar epithelial cells .

  • YAP1 signaling: Claudin-18 regulates epithelial progenitor cell proliferation and organ size by influencing YAP1 localization away from the nucleus, thereby restricting YAP1 target gene transcription .

  • RANKL signaling: It acts as a negative regulator of RANKL-induced osteoclast differentiation, potentially through relocating TJP2/ZO-2 away from the nucleus, which affects bone resorption in response to calcium deficiency .

  • Estrogen signaling: Claudin-18 mediates the osteoprotective effects of estrogen, possibly acting downstream of estrogen signaling independently of RANKL pathways .

What are the optimal storage and reconstitution conditions for recombinant Mouse Claudin-18?

Recombinant Mouse Claudin-18 protein is typically supplied as a lyophilized powder and requires proper reconstitution and storage to maintain its activity. For optimal results, follow these guidelines:

  • Storage before reconstitution: Store the lyophilized protein at -20°C to -80°C upon receipt.

  • Reconstitution procedure:

    • Briefly centrifuge the vial before opening to bring the contents to the bottom

    • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • It is recommended to add glycerol (5-50% final concentration) to prevent freeze-thaw damage

  • Storage after reconstitution:

    • For long-term storage: Aliquot and store at -20°C or -80°C (50% glycerol recommended)

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they may denature the protein

This careful handling ensures the recombinant protein maintains its structural integrity and functional properties for experimental applications.

How can researchers validate the activity of recombinant Mouse Claudin-18 for experimental use?

Researchers can validate the activity of recombinant Mouse Claudin-18 through several approaches:

  • Functional ELISA: A primary method involves measuring the binding ability of the protein in a functional ELISA. For example, immobilized Mouse Cldn18 at 5 μg/mL can bind Anti-CLDN18.2 recombinant antibody with an EC50 of 6.115-11.01 ng/mL . This assay confirms that the recombinant protein maintains its proper conformation and binding epitopes.

  • Western blot analysis: Using specific antibodies against Claudin-18 or the His-tag to confirm the identity and integrity of the recombinant protein.

  • Tight junction formation assays: When expressed in epithelial cell lines, functional Claudin-18 should localize to cell-cell contacts and contribute to increased transepithelial electrical resistance (TER).

  • Pull-down assays: These can be used to verify interaction with known binding partners of Claudin-18, such as other tight junction proteins.

  • Endotoxin testing: Ensure the protein preparation has low endotoxin levels (<1.0 EU/μg as determined by LAL method) to prevent experimental artifacts .

These validation steps are crucial before proceeding with complex experiments to ensure that observed effects are due to the specific activity of Claudin-18 rather than experimental artifacts.

What experimental systems are most appropriate for studying recombinant Mouse Claudin-18 function?

Several experimental systems are particularly suitable for studying recombinant Mouse Claudin-18 function:

  • Alveolar epithelial cell (AEC) monolayers: These provide an excellent model for studying Claudin-18's role in tight junction formation and epithelial barrier function. C18 KO AEC monolayers have been shown to exhibit lower transepithelial electrical resistance and increased solute and ion permeability .

  • Mouse models:

    • Claudin-18 knockout mice (C18 KO) generated by crossing floxed claudin-18 mice to CMV-Cre deleter strains provide an in vivo system for studying the protein's physiological roles

    • Tissue-specific conditional knockout models can help distinguish between the roles of Claudin-18 in different organs

  • Stable cell lines expressing Claudin-18: These are useful for studying protein-protein interactions, trafficking, and post-translational modifications

  • Cancer cell models: Given Claudin-18.2's overexpression in certain cancers, cancer cell lines can be valuable for studying its role in pathological conditions

  • Reconstituted tight junction systems: These allow for the study of how Claudin-18 interacts with other tight junction components to form functional barriers

Each system offers distinct advantages depending on the specific research question being addressed, with in vitro models providing controlled conditions for mechanistic studies and in vivo models offering physiological relevance.

How can researchers effectively measure changes in epithelial barrier function related to Claudin-18?

Researchers can employ several sophisticated techniques to quantify changes in epithelial barrier function related to Claudin-18:

  • Transepithelial Electrical Resistance (TER): This technique measures the electrical resistance across an epithelial monolayer, providing real-time information about tight junction integrity. Studies with C18 KO alveolar epithelial cell monolayers have demonstrated lower TER, indicating compromised barrier function .

  • Paracellular Flux Assays: These involve measuring the passage of different sized tracers (e.g., fluorescein-labeled dextrans, fluorescein-BSA) across epithelial monolayers. In C18 KO mice, increased permeability to fluorescein-BSA has been observed, with a 2.9-fold increase in lung permeability index compared to wild-type mice .

  • Ion Selectivity Measurements: Using electrophysiological techniques to determine changes in ion selectivity across tight junctions. Interestingly, C18 KO alveolar epithelial cell monolayers showed increased ion permeability but unchanged ion selectivity .

  • Alveolar Fluid Clearance (AFC) Measurements: In lung studies, measuring the rate of fluid removal from alveolar spaces can provide insights into Claudin-18's role in fluid homeostasis. C18 KO mice exhibited increased AFC associated with enhanced β-adrenergic receptor signaling .

  • Freeze-Fracture Electron Microscopy: This technique visualizes tight junction strand architecture and can reveal structural changes in tight junctions resulting from Claudin-18 manipulation.

When employing these techniques, it is essential to include appropriate controls and standardize experimental conditions to ensure reproducibility and meaningful comparison between different experimental groups.

What are the molecular mechanisms behind Claudin-18's regulation of alveolar fluid homeostasis?

The molecular mechanisms underlying Claudin-18's regulation of alveolar fluid homeostasis involve a complex interplay between tight junction permeability and active ion transport processes:

  • Tight Junction Composition Regulation: Claudin-18 is a key determinant of alveolar epithelial tight junction composition. Its absence leads to compensatory increases in other claudins, particularly claudin-3 (1.83-fold increase) and claudin-4 (3.99-fold increase) . This altered tight junction composition affects paracellular permeability to ions and solutes.

  • Influence on β-adrenergic Signaling: Claudin-18 appears to negatively regulate β-adrenergic receptor signaling. In C18 KO mice, increased β-adrenergic receptor activity leads to:

    • Activation of cystic fibrosis transmembrane conductance regulator (CFTR)

    • Enhanced epithelial sodium channel (ENaC) activity

    • Increased Na-K-ATPase activity and upregulated Na-K-ATPase β1 subunit expression

  • Cytoskeletal Organization: Claudin-18 influences actin cytoskeleton organization, which in turn affects tight junction stability and function. Microarray analysis of C18 KO mice revealed changes in cytoskeleton-associated gene expression, consistent with observed F-actin cytoskeletal rearrangement in alveolar epithelial cell monolayers .

  • Balancing Mechanism: Despite increased paracellular permeability in C18 KO mice, they do not develop pulmonary edema due to compensatory increases in alveolar fluid clearance. This suggests Claudin-18 participates in a homeostatic mechanism that balances fluid leak and clearance in the lungs .

This integrated regulation highlights how Claudin-18 serves as a crucial link between tight junction barrier properties and active ion transport processes that drive alveolar fluid movement.

What techniques can be used to study the interaction of Claudin-18 with other tight junction proteins?

Several advanced techniques can be employed to investigate the interactions between Claudin-18 and other tight junction proteins:

  • Co-immunoprecipitation (Co-IP): This technique can identify protein-protein interactions by using antibodies to isolate Claudin-18 along with its binding partners from cell or tissue lysates. Western blotting can then identify the co-precipitated proteins.

  • Proximity Ligation Assay (PLA): This method detects protein interactions in situ with high sensitivity and specificity, allowing visualization of Claudin-18 interactions with other tight junction proteins in their native cellular context.

  • Förster Resonance Energy Transfer (FRET): By tagging Claudin-18 and potential interaction partners with appropriate fluorophores, FRET microscopy can detect close proximity between proteins, indicating direct interaction.

  • Bimolecular Fluorescence Complementation (BiFC): This technique involves splitting a fluorescent protein and fusing each half to potential interaction partners. Fluorescence is reconstituted only when the proteins interact, bringing the two halves together.

  • Super-resolution Microscopy: Techniques such as STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) provide nanoscale resolution of protein localization within tight junctions, revealing co-localization patterns not visible with conventional microscopy.

  • Crosslinking Mass Spectrometry: This approach can identify interaction interfaces between Claudin-18 and other proteins at the amino acid level.

  • Heterologous Expression Systems: Transfecting cells with Claudin-18 and other tight junction proteins to study their co-localization and functional interaction in a controlled environment.

These complementary approaches provide a comprehensive understanding of how Claudin-18 interacts with other tight junction components to form functional barriers.

How does Claudin-18.2 expression differ between normal and cancer tissues, and what are the implications for cancer research?

Claudin-18.2, a specific isoform of Claudin-18, exhibits distinct expression patterns in normal versus cancerous tissues, with significant implications for cancer research:

Normal tissues:

  • Claudin-18.2 expression is largely restricted to differentiated epithelial cells of the gastric mucosa and lung alveoli

  • Expression is polarized to tight junctions where it maintains epithelial barrier function

  • Expression levels are tightly regulated during development and tissue homeostasis

Cancer tissues:

  • Claudin-18.2 is frequently overexpressed in gastric cancer and pancreatic adenocarcinomas

  • It is also found in a fraction of non-small cell lung cancer cases

  • In malignant tissues, its normal polarized distribution may become disrupted, with expression throughout the cell membrane making it more accessible to antibody-based therapeutics

Research implications:

  • Biomarker potential: The selective overexpression in certain cancers makes Claudin-18.2 a valuable biomarker for diagnosis and monitoring disease progression

  • Therapeutic target: Its accessibility on cancer cells has led to the development of targeted therapeutics, such as monoclonal antibodies (e.g., Zolbetuximab) and VHH-based recombinant antibodies

  • Mechanistic insights: Understanding how Claudin-18.2 contributes to cancer cell biology provides insights into epithelial-derived cancers and potential vulnerabilities that can be therapeutically exploited

These distinct expression patterns position Claudin-18.2 as an "attractive drug target for gastric and pancreatic cancers" , providing opportunities for developing novel therapeutic approaches with potentially improved specificity and reduced side effects compared to conventional chemotherapies.

What are the latest developments in antibody-based therapeutics targeting Claudin-18.2 for cancer treatment?

Recent advances in antibody-based therapeutics targeting Claudin-18.2 have shown promising results for cancer treatment, particularly for gastric and pancreatic cancers:

  • Humanized VHH-based therapeutics:

    • Variable domains of heavy chain of heavy chain antibodies (VHHs) isolated from immunized alpacas have been humanized and fused with human IgG1 Fc

    • These constructs (e.g., hu7v3-Fc) have demonstrated desirable binding specificity and high affinity to CLDN18.2

    • In vitro studies show these antibodies can effectively elicit both antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against CLDN18.2-positive tumor cells

  • Comparative efficacy with conventional antibodies:

    • In mouse xenograft models, the anti-tumor efficacy of hu7v3-Fc was significantly more potent than Zolbetuximab (the benchmark anti-CLDN18.2 monoclonal antibody)

    • In vivo biodistribution studies using zirconium-89 labeled antibodies demonstrated that hu7v3-Fc exhibited better tumor penetration and faster tumor uptake compared to Zolbetuximab

  • Advantages of VHH-based approaches:

    • The smaller size of VHH-based antibodies contributes to improved tumor penetration

    • Higher affinity binding enhances therapeutic efficacy

    • The modular nature of VHH domains makes them versatile building blocks for developing novel CLDN18.2-targeted therapeutics

These developments suggest that humanized VHH-based antibodies targeting CLDN18.2 represent a promising new direction in targeted cancer therapy, potentially offering improved efficacy over conventional monoclonal antibodies.

How do Claudin-18 knockout models inform our understanding of pulmonary diseases and potential therapeutic approaches?

Claudin-18 knockout (C18 KO) mouse models have provided valuable insights into pulmonary diseases and potential therapeutic approaches:

  • Barrier function and disease susceptibility:

    • C18 KO mice exhibit increased alveolar epithelial permeability, suggesting that Claudin-18 deficiency could contribute to pathologies where barrier dysfunction plays a role, such as acute respiratory distress syndrome (ARDS) or ventilator-induced lung injury

    • Despite increased permeability, C18 KO mice do not develop pulmonary edema at baseline, indicating compensatory mechanisms that could be therapeutically targeted

  • Alveolar fluid clearance mechanisms:

    • C18 KO mice show increased alveolar fluid clearance (AFC) associated with enhanced β-adrenergic receptor signaling

    • This leads to activation of cystic fibrosis transmembrane conductance regulator (CFTR), increased epithelial sodium channel (ENaC) activity, and elevated Na-K-ATPase function

    • These findings suggest potential therapeutic targets for conditions characterized by impaired fluid clearance, such as pulmonary edema

  • Tight junction remodeling:

    • Loss of Claudin-18 leads to compensatory increases in other claudins (particularly claudin-3 and claudin-4)

    • This junctional remodeling suggests that targeting specific claudin expression patterns might be a viable approach for modulating epithelial barrier function in disease states

  • Cytoskeletal regulation:

    • Microarray analysis of C18 KO mice revealed changes in cytoskeleton-associated gene expression

    • This finding connects Claudin-18 to cytoskeletal organization, suggesting potential therapeutic approaches targeting the cytoskeleton in barrier dysfunction diseases

  • Lung alveolarization:

    • Claudin-18 is required for lung alveolarization and maintenance of the paracellular alveolar epithelial barrier

    • This insight is relevant to developmental lung disorders and conditions involving aberrant repair processes

These findings from knockout models provide a foundation for developing targeted therapies for pulmonary diseases involving epithelial barrier dysfunction and fluid homeostasis disturbances.

What are the key considerations when designing experiments with recombinant Mouse Claudin-18?

When designing experiments with recombinant Mouse Claudin-18, researchers should consider several critical factors to ensure valid and reproducible results:

  • Protein quality and validation:

    • Verify protein purity and activity before experiments (functional ELISA recommended)

    • Confirm low endotoxin levels (<1.0 EU/μg) to prevent inflammatory artifacts

    • Validate proper folding and epitope accessibility through binding assays

  • Expression system selection:

    • Mammalian expression systems are preferred for producing recombinant Claudin-18 to ensure proper post-translational modifications

    • The recombinant protein should include the full-length sequence (1-264 amino acids) to maintain native functional properties

  • Tagged versus untagged protein considerations:

    • His-tagged Claudin-18 (N-6His) is commonly used for purification and detection purposes

    • Consider whether the tag might interfere with specific functions or interactions being studied

    • For certain applications, tag cleavage might be necessary

  • Reconstitution and storage protocols:

    • Proper reconstitution in appropriate buffers is essential (typically deionized sterile water)

    • Addition of glycerol (5-50%) is recommended for long-term storage

    • Aliquoting prevents repeated freeze-thaw cycles that can compromise protein integrity

  • Experimental controls:

    • Include appropriate negative controls (buffer-only, irrelevant proteins)

    • Use positive controls when available (known binding partners or functional readouts)

    • For knockout complementation studies, consider including both wild-type and mutant versions of Claudin-18

  • Physiological relevance:

    • Design experiments that reflect the physiological context of Claudin-18 in tight junctions

    • Consider using polarized epithelial cell systems for more relevant functional studies

Careful attention to these considerations will enhance the reliability and biological relevance of experiments using recombinant Mouse Claudin-18.

How can researchers effectively perform comparative analysis between Claudin-18 and other claudin family members?

Performing effective comparative analysis between Claudin-18 and other claudin family members requires a systematic approach:

  • Sequence and structural analysis:

    • Conduct sequence alignments to identify conserved domains and unique features

    • Create phylogenetic trees to understand evolutionary relationships

    • Use structural prediction tools to compare protein folding patterns and potential functional domains

  • Expression profiling:

    • Compare tissue-specific expression patterns using quantitative PCR, western blotting, or immunohistochemistry

    • Analyze single-cell RNA sequencing data to identify cell types expressing different claudins

    • Study developmental expression patterns to understand temporal regulation

  • Functional complementation studies:

    • Express different claudins in knockout models to assess functional redundancy

    • In C18 KO models, significant upregulation of claudin-3 (1.83-fold) and claudin-4 (3.99-fold) has been observed, suggesting compensatory mechanisms

    • Create chimeric proteins to identify which domains confer specific functions

  • Barrier property comparisons:

    • Measure transepithelial electrical resistance (TER) in cell models expressing different claudins

    • Assess ion and solute permeability profiles to characterize barrier properties

    • Quantify the effects on paracellular flux of different sized tracers

  • Protein interaction networks:

    • Compare protein-protein interaction profiles using techniques like co-immunoprecipitation

    • Identify shared and unique binding partners

    • Map interaction domains through deletion mutants

  • Response to physiological stimuli:

    • Compare how different claudins respond to stimuli like cytokines, growth factors, or mechanical stress

    • Analyze post-translational modifications in response to various stimuli

This multifaceted approach allows researchers to comprehensively characterize the unique and shared properties of Claudin-18 relative to other family members, providing insights into their specialized functions in different tissues and physiological contexts.

What are the current limitations in Claudin-18 research and how might they be addressed?

Current research on Claudin-18 faces several significant limitations that require innovative approaches to overcome:

  • Structural characterization challenges:

    • Limitation: As a membrane protein with multiple transmembrane domains, obtaining high-resolution structural data for Claudin-18 is challenging

    • Solution: Employ advanced techniques such as cryo-electron microscopy or X-ray crystallography with stabilizing nanobodies to elucidate the complete structure

  • Isoform-specific functions:

    • Limitation: Difficulty in distinguishing the specific functions of Claudin-18 isoforms (particularly 18.1 and 18.2) in different tissues

    • Solution: Develop isoform-specific knockout models and antibodies that can precisely target individual isoforms

  • Dynamic regulation understanding:

    • Limitation: Limited knowledge about how Claudin-18 is dynamically regulated in response to physiological stimuli

    • Solution: Implement live-cell imaging approaches with fluorescently tagged Claudin-18 to monitor trafficking and localization in real-time

  • Translational research gaps:

    • Limitation: Challenges in translating findings from mouse models to human physiology and pathology

    • Solution: Develop humanized mouse models and use human cell-derived organoids to bridge this gap

  • Technical difficulties in purification:

    • Limitation: Obtaining functional recombinant Claudin-18 with proper folding and post-translational modifications

    • Solution: Refine mammalian expression systems and purification protocols to enhance protein quality and yield

  • Heterogeneity in experimental conditions:

    • Limitation: Variability in experimental conditions across studies makes comparative analysis difficult

    • Solution: Establish standardized protocols for Claudin-18 experiments and create reference datasets

  • Complex compensatory mechanisms:

    • Limitation: Knockout models often exhibit compensatory upregulation of other claudins, complicating interpretation

    • Solution: Develop acute, inducible knockout systems to minimize compensatory adaptations and use multi-claudin knockout models to address redundancy

Addressing these limitations will require collaborative efforts across disciplines, combining expertise in structural biology, cell biology, genetics, and clinical research to advance our understanding of Claudin-18's functions in health and disease.

What are the promising research directions for Claudin-18 in cancer immunotherapy?

Several promising research directions are emerging for Claudin-18 in cancer immunotherapy:

  • Enhanced antibody-drug conjugates (ADCs):

    • Coupling potent cytotoxic agents to anti-Claudin-18.2 antibodies to increase therapeutic efficacy

    • Developing novel linker technologies that allow for tumor-specific drug release

    • Investigating combination strategies with conventional chemotherapies for synergistic effects

  • Bispecific antibody approaches:

    • Designing bispecific antibodies that simultaneously target Claudin-18.2 and immune cells (T cells, NK cells)

    • Exploring formats that optimize tumor penetration while maintaining effector functions

    • Building upon the successful VHH-based platforms that have already shown improved tumor penetration compared to conventional antibodies

  • CAR-T cell therapy development:

    • Engineering chimeric antigen receptor T cells (CAR-T) targeting Claudin-18.2

    • Optimizing CAR designs to enhance persistence, tumor infiltration, and cytotoxic activity

    • Developing strategies to overcome the immunosuppressive tumor microenvironment

  • Combination immunotherapy strategies:

    • Investigating synergistic effects of anti-Claudin-18.2 therapy with immune checkpoint inhibitors

    • Exploring combinations with therapies targeting the tumor microenvironment

    • Developing rational sequencing approaches for maximum therapeutic benefit

  • Personalized therapy approaches:

    • Implementing companion diagnostics to identify patients most likely to benefit from Claudin-18.2-targeted therapies

    • Developing biomarkers to monitor treatment response and resistance mechanisms

    • Creating patient-derived xenograft models to test therapeutic efficacy prior to treatment

These research directions leverage the advantageous properties of Claudin-18.2 as a cancer target, including its selective expression pattern and accessibility on the cancer cell surface, while addressing current limitations in cancer immunotherapy approaches.

How might systems biology approaches advance our understanding of Claudin-18's role in epithelial homeostasis?

Systems biology approaches offer powerful frameworks for understanding Claudin-18's complex role in epithelial homeostasis:

These systems biology approaches would provide a more holistic understanding of how Claudin-18 contributes to epithelial homeostasis beyond its direct role in tight junction formation, revealing emergent properties and network effects that could not be identified through reductionist approaches alone.

What novel methodologies are being developed to enhance the study of tight junction proteins like Claudin-18?

Several innovative methodologies are being developed that promise to enhance our understanding of tight junction proteins like Claudin-18:

  • Advanced imaging technologies:

    • Super-resolution microscopy techniques (STORM, PALM, STED) that overcome the diffraction limit to visualize tight junction architecture at nanoscale resolution

    • Label-free imaging methods such as coherent anti-Stokes Raman scattering (CARS) microscopy to observe native tight junctions without potentially disruptive fluorescent tags

    • 4D live-cell imaging to track dynamic changes in tight junction composition and Claudin-18 trafficking in real time

  • Single-molecule techniques:

    • Single-molecule force spectroscopy to measure the strength of Claudin-18 interactions with other tight junction components

    • Single-molecule tracking to follow the movements of individual Claudin-18 proteins within the membrane

    • Single-molecule FRET to detect conformational changes in Claudin-18 in response to various stimuli

  • Organoid and microphysiological systems:

    • Lung and gastric organoids that recapitulate the 3D architecture of native epithelia for studying Claudin-18 in a physiologically relevant context

    • Organ-on-chip platforms that incorporate fluid flow and mechanical forces to mimic the in vivo microenvironment

    • Co-culture systems that model epithelial-stromal interactions affecting tight junction regulation

  • CRISPR-based technologies:

    • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) for precise temporal control of Claudin-18 expression

    • Base editing and prime editing for introducing specific mutations to study structure-function relationships

    • CRISPR screens to identify genes that interact with Claudin-18 or modify its function

  • Artificial intelligence and computational approaches:

    • Deep learning algorithms for analyzing complex tight junction patterns in imaging data

    • Molecular dynamics simulations to predict how Claudin-18 assembles into tight junction strands

    • Natural language processing to synthesize knowledge from vast literature on tight junction biology

  • Synthetic biology approaches:

    • Engineered minimal tight junctions with defined composition to understand the specific contribution of Claudin-18

    • Optogenetic tools to control Claudin-18 function with light

    • Biosensors that report on tight junction integrity and Claudin-18 activity in real time

These methodological innovations will provide unprecedented insights into Claudin-18's molecular mechanisms, dynamic behavior, and functional interactions, advancing both basic science understanding and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.