Recombinant Mouse Claudin-1 (Cldn1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant Mouse Claudin-1 is typically expressed in heterologous systems for high purity and activity:

Expression Systems:

Host SystemTagPurityApplicationSource
HEK293 cellsMyc-DDK>80%ELISA, WB
Cell-free synthesisStrep Tag>70%Structural studies
Wheat germGST Tag>90%Antibody production

Purification:

  • Affinity chromatography (e.g., GST/Strep-Tag)

  • Stabilized using lipid-based platforms for membrane protein integrity

Cancer Metastasis

  • Role: Mouse Cldn1 suppresses lung adenocarcinoma metastasis by enhancing cell-cell adhesion and downregulating invasion-promoting genes (e.g., SPP1, TGF-α) .

  • Key Findings:

    • Overexpression reduced metastatic nodules by 60% in murine models .

    • Knockdown increased invasiveness via MMP-2 activation .

Viral Entry Mechanisms

  • HCV Infection: Acts as a co-receptor with CD81 for viral entry in hepatocytes .

    • Anti-CLDN1 antibodies blocked HCV infection in vitro (IC₅₀: 2.5 µg/mL) and in vivo .

  • Dengue Virus: CLDN1 facilitates DENV entry in epithelial cells .

Bone Biology

  • Osteoblast Regulation:

    • Knockdown in MC3T3-E1 cells reduced proliferation (-18%), ALP activity (-41%), and β-catenin levels .

    • Upregulated by Wnt3a and IGF-1 during differentiation .

Functional Data

Table 1: Biochemical Properties

PropertyValueSource
Isoelectric Point (pI)8.2
Thermal StabilityStable at -80°C (lyophilized)
Binding Affinity (KD)10⁻⁹ M (for CD81)

Table 2: Disease Associations

ConditionCLDN1 ExpressionMechanism
Lung AdenocarcinomaLoss of cell adhesion
Atopic DermatitisBarrier dysfunction
Hepatitis CViral entry facilitation

Challenges and Future Directions

  • Species Specificity: Human CLDN1 antibodies (e.g., clone 7A5) show limited cross-reactivity with mouse isoforms .

  • Therapeutic Potential: CLDN1-targeted biologics face challenges due to compensatory upregulation of CLDN6/9 in some cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cldn1; Claudin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Cldn1
Target Protein Sequence
MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV IGGIIFLISGLATLVATAWYGNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGV LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV
Uniprot No.

Target Background

Function
Claudins are essential components of tight junction complexes, regulating epithelial permeability. While some claudins establish impermeable barriers, others facilitate ion and small molecule permeability. Co-expression and interaction among claudins determine overall permeability. CLDN1 is vital for preventing paracellular diffusion of small molecules in the epidermis, maintaining skin barrier function. It is crucial for water homeostasis, preventing excessive transepidermal water loss, likely through indirect effects on the expression of other proteins, as CLDN1 itself appears dispensable for water barrier formation in keratinocyte tight junctions.
Gene References Into Functions
  1. BTZ-induced claudin-1 expression offers a potential therapeutic strategy for atopic dermatitis (AD). PMID: 28859979
  2. TLR4-dependent claudin-1 internalization and secondary anion secretion contribute to irinotecan-induced diarrhea. PMID: 27550942
  3. miR-29a may regulate tumor growth and migration by targeting CLDN1. PMID: 28342862
  4. Claudin-1 expression is dysregulated in Msx1d/d/Msx2d/d uteri. PMID: 26667042
  5. Cldn-1 positively regulates osteoblast proliferation and differentiation. PMID: 25479235
  6. KRT76 interacts with CLDN1, suggesting this interaction is essential for proper CLDN1 localization in tight junctions. PMID: 25340345
  7. MIR29 targets and reduces CLDN1 and NKRF expression, increasing intestinal permeability in inflammatory bowel disease. PMID: 25277410
  8. Occludin and Claudin-1 expression in the large intestine exhibits circadian control, impacting colonic permeability and colitis susceptibility. PMID: 24845399
  9. CLDN1 regulates intestinal epithelial homeostasis via Notch signaling. PMID: 23766441
  10. Sirt1 downregulation and Claudin-1 upregulation, mediated by SIRT1-dependent epigenetic regulation in podocytes, contribute to albuminuria. PMID: 24141423
  11. Cldn1-/- mice exhibit abnormal stratum granulosum formation and stratum corneum barrier defects. PMID: 23433550
  12. miR-155 may prevent ovarian cancer tumorigenesis by downregulating CLDN1. PMID: 23523916
  13. Claudin-1 is expressed in various inner ear epithelial tissues, including the Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, and vestibular sensory epithelia. PMID: 14698084
  14. Cldn1, Cldn2, and Cldn11 distinguish diverse M2 macrophage types. PMID: 22268650
  15. Mouse CLDN1 (mCLDN1) supports HCV genotype 2a infection with moderate efficiency, suggesting CLDN1 contributes to HCV's restricted species tropism. PMID: 19889758
  16. Studies explore the dynamic behavior of claudin-1 paired strands in cell membranes. PMID: 12651952
  17. Thr203 of claudin-1 is crucial for enhancing barrier function, likely through phosphorylation and integration into tight junctions. PMID: 15051488
  18. In the absence of follicle-stimulating hormone receptor signaling, claudin-1 decreases in ovarian surface epithelium and tumors compared to wild type. PMID: 17217615
  19. Claudin-1 is found in murine Langerhans cells (LC) in the epidermis. TGF-beta stimulates claudin-1 mRNA and protein accumulation in cultured bone marrow cells, suggesting a role in LC adhesion and migration. PMID: 17508021
  20. Cldn1 is localized in the epidermis, nail, dorsal tongue surface, and glandular stomach compartment but is absent from the oral mucosa and keratinized stomach compartment. PMID: 17828607
  21. Nectin plays a role in co-localizing JAM and claudin at cell-cell adhesion membrane domains. PMID: 18547333
  22. Claudin-1 is a p63 target gene crucial for epithelial development. PMID: 18648642
  23. IGF-I-induced claudin-1 expression and paracellular permeability during osteoblast-like MC3T3-E1 cell differentiation are regulated via a MAP-kinase pathway, independently of gap junctions. PMID: 18855015
  24. The conserved "dFynPl" sequence is essential for claudin-1's tight junction strand formation. PMID: 19234713
  25. LNX1p80 is involved in claudin ubiquitylation, endocytosis, and lysosomal degradation, regulating tight junction turnover through ubiquitylation. PMID: 19295125
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Tissue Specificity
Detected in epidermis and liver (at protein level). Widely expressed, with highest levels in liver and kidney.

Q&A

What is the full amino acid sequence of Mouse Claudin-1?

Mouse Claudin-1 consists of 211 amino acids with a sequence highly homologous to human Claudin-1. The human sequence is: MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTSYPTPRPYPKPAPSSGKDYV . Mouse Claudin-1 shares approximately 90% sequence identity with human Claudin-1, with most variations occurring in the C-terminal cytoplasmic domain.

What are the primary functions of Claudin-1 in biological systems?

Claudin-1 functions as a major constituent of tight junction complexes that regulate epithelial permeability. It plays essential roles in:

  • Preventing paracellular diffusion of small molecules through tight junctions in the epidermis

  • Maintaining normal barrier function of the skin

  • Regulating water homeostasis and preventing excessive water loss through the skin

  • Contributing to the selective ion permeability of various epithelial tissues

Unlike some claudin family members that form permeable barriers, Claudin-1 primarily contributes to impermeable barrier formation, although its specific function may vary depending on which other claudins it is co-expressed with in a given tissue .

What expression systems are most effective for producing recombinant Mouse Claudin-1?

Several expression systems have been successfully used for recombinant Claudin-1 production:

  • Yeast expression (P. pastoris): Provides high yields and proper protein folding. This system has been demonstrated to produce correctly folded, antigenic Claudin-1 that forms oligomeric structures similar to those observed in mammalian cells .

  • Wheat germ cell-free expression system: Effective for producing full-length Claudin-1 (amino acids 1-211) suitable for applications such as ELISA and Western blotting .

  • Mammalian expression systems: While not detailed in the provided search results, these systems can provide native-like post-translational modifications but typically with lower yields than yeast systems.

The choice depends on your downstream applications, with yeast systems offering a good balance between yield and proper folding for structural and functional studies .

What are the optimal detergents for extraction and purification of Claudin-1?

The choice of detergent significantly impacts the oligomeric state and functionality of extracted Claudin-1:

DetergentResulting Claudin-1 StateAdvantagesLimitations
n-octyl-β-d-glucopyranoside (βOG)Monodispersed dimersIdeal for biophysical studies requiring homogeneous preparationsMay not reflect native oligomerization state
Profoldin-8Dynamic mixture of oligomersBetter represents native stateLess suitable for certain structural analyses
n-decylphosphocholineDynamic mixture of oligomersBetter represents native stateLess suitable for certain structural analyses
Foscholine-10Dynamic oligomeric forms capable of associating with CD81Enables protein-protein interaction studiesLess stable preparations

For biophysical characterization requiring monodispersed samples, βOG extraction followed by nickel-affinity chromatography and size exclusion chromatography is recommended .

How can the oligomeric state of recombinant Claudin-1 be determined?

The oligomeric state of Claudin-1 can be analyzed using several complementary approaches:

  • Analytical ultracentrifugation (AUC): Provides definitive data on the size distribution and oligomeric state of purified Claudin-1 in detergent solutions. This has revealed that βOG extraction yields monodispersed dimers while other detergents produce dynamic mixtures of oligomers .

  • SDS-PAGE under non-reducing conditions: Can reveal the presence of higher-order oligomers that are stabilized by disulfide bonds .

  • Dynamic light scattering (DLS): Useful for analyzing the hydrodynamic radius of Claudin-1 oligomers and monitoring complex formation with interacting partners such as CD81 .

  • Native PAGE: Although not explicitly mentioned in the search results, this technique can provide information about non-covalent oligomeric assemblies.

For comprehensive characterization, a combination of these methods is recommended to overcome the limitations of any single approach.

How does Claudin-1 interact with other tight junction proteins and viral receptors?

Claudin-1 forms specific protein-protein interactions that are critical for its biological functions:

  • Interaction with CD81: Recombinant Claudin-1 associates with CD81 in vitro in a defined molar ratio of 1:2 (Claudin-1:CD81). This interaction occurs in the absence of other cellular components and is enhanced by cholesteryl hemisuccinate, consistent with reports that cholesterol promotes complex formation in mammalian cells .

  • Claudin-1/CD81 complex: Forms a receptor complex essential for hepatitis C virus (HCV) entry into hepatocytes. Dynamic preparations of Claudin-1 (in foscholine-10) can associate with CD81, while monodispersed Claudin-1 (in βOG) fails to form this complex .

  • Viral receptor function: While human Claudin-1 serves as a co-receptor for HCV and a receptor for dengue virus, mouse Claudin-1 may have different binding affinities for these pathogens due to sequence variations .

To study these interactions, researchers can use purified proteins in detergent micelles or reconstituted proteoliposomes, although the latter may be challenging as Claudin-1 incorporation can render proteoliposomes intractable to study .

What are the validated applications for antibodies against Mouse Claudin-1?

Antibodies against Claudin-1 have been validated for multiple applications:

  • Western Blotting (WB): For detecting Claudin-1 in protein extracts and assessing expression levels .

  • Enzyme-Linked Immunosorbent Assay (ELISA): For quantitative detection of Claudin-1 .

  • Immunohistochemistry (IHC): Particularly in paraffin-embedded sections (IHC-P), allowing visualization of Claudin-1 localization in tissues .

  • Immunoprecipitation (IP): For isolating Claudin-1 and its binding partners .

  • Immunofluorescence (IF): For subcellular localization studies, though this was not explicitly mentioned for mouse Claudin-1 in the search results.

When selecting antibodies, consider whether they recognize conformational epitopes (for native protein studies) or linear epitopes (better for denatured protein detection) .

What methods can verify the correct folding of recombinant Claudin-1?

Verifying correct folding is crucial for functional studies. Several approaches include:

  • Conformation-dependent antibody binding: Antibodies that recognize native epitopes can be used in flow cytometry or confocal imaging to confirm proper folding. Studies have shown specific binding of such antibodies to yeast-expressed Claudin-1 .

  • Circular dichroism (CD) spectroscopy: Though not mentioned in the search results, this technique can assess secondary structure content.

  • Functional binding assays: While recombinant Claudin-1 does not directly bind soluble HCV E2 glycoprotein (sE2), its ability to form specific complexes with CD81 indicates correct folding .

  • Oligomerization analysis: Properly folded Claudin-1 forms specific oligomeric states that can be detected by analytical techniques as discussed in section 3.1 .

These complementary approaches provide different insights into protein structure and should be selected based on your specific research questions.

How can recombinant Claudin-1 be used for structural biology studies?

Structural analysis of Claudin-1 presents several challenges and opportunities:

  • Protein production: Expressing Claudin-1 in yeast (P. pastoris) followed by extraction with appropriate detergents provides material suitable for structural studies .

  • Protein stabilization: The dynamic nature of Claudin-1 oligomers presents challenges for crystallization. Monodispersed preparations (in βOG) may be more amenable to crystallization attempts, while dynamic preparations better represent physiological states .

  • Complex formation: The ability to form defined complexes with CD81 (1:2 ratio) in vitro opens possibilities for structural studies of the receptor complex relevant to HCV entry .

  • Reconstitution systems: While challenging due to the effects of Claudin-1 on liposome properties, reconstitution into nanodiscs or other membrane mimetics may provide platforms for structural analysis .

The first in-depth characterization of recombinant, full-length Claudin-1 has paved the way for structural analysis of the claudin superfamily and structure-aided design of therapeutic agents targeting processes such as HCV entry .

What factors influence Claudin-1 oligomerization and how can researchers control this process?

Claudin-1 oligomerization is influenced by multiple factors that researchers can manipulate:

  • Detergent selection: Different detergents yield different oligomeric states - βOG produces dimers while foscholine-10 and other detergents yield dynamic mixtures of oligomers .

  • Cholesterol content: Claudin-1 complexes are stabilized by cholesteryl hemisuccinate, indicating that membrane cholesterol content significantly influences oligomerization and protein-protein interactions .

  • Reducing conditions: Non-reducing SDS-PAGE reveals diverse oligomeric states compared to reducing conditions, suggesting disulfide bonds may stabilize some oligomeric forms .

  • Membrane environment: Reconstitution into liposomes with defined lipid composition can influence oligomerization, although working with Claudin-1-containing proteoliposomes presents technical challenges .

  • Protein concentration: Though not explicitly mentioned in the search results, protein concentration typically influences oligomerization equilibria.

Understanding these factors allows researchers to design experiments with appropriate controls for the desired oligomeric state of Claudin-1.

How does Mouse Claudin-1 differ from Human Claudin-1 in disease models?

While the search results focus primarily on human Claudin-1, important differences between mouse and human Claudin-1 affect their use in disease models:

  • Viral receptor function: Human Claudin-1 serves as a co-receptor for HCV and associates with CD81 to facilitate viral entry, but mouse Claudin-1 may have different binding affinities for viral proteins due to sequence variations .

  • Species-specific interactions: The interaction between Claudin-1 and other tight junction proteins may vary between species, affecting the interpretation of mouse models for human diseases.

  • Tissue-specific expression patterns: While many expression patterns are conserved, subtle differences in tissue-specific expression or regulation between mouse and human Claudin-1 may impact disease modeling.

Researchers should consider these differences when translating findings between mouse models and human disease, particularly for infectious disease studies involving HCV or dengue virus .

What is the potential of Claudin-1-targeted nanoparticles for drug delivery?

Claudin-1-targeted nanoparticles represent an emerging approach for targeted drug delivery:

  • Targeting specificity: Claudin-1's expression in tight junctions of specific epithelia makes it a potential target for delivering drugs to these barriers .

  • Barrier penetration: Targeting Claudin-1 may facilitate drug delivery across otherwise impermeable epithelial barriers .

  • Disease-specific applications: Altered Claudin-1 expression in certain disease states (such as inflammatory conditions or cancers) offers opportunities for targeted therapies .

While the search results contain limited information on this topic (with result being cut off), the development of Claudin-1-targeted nanoparticles highlights the potential therapeutic applications of understanding Claudin-1 biology and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.