Recombinant Mouse Claudin-2 (Cldn2)

Shipped with Ice Packs
In Stock

Description

Role in Colorectal Cancer Metastasis

  • Mechanism: CLDN2 promotes liver and lung metastasis by forming a complex with ZO1/ZONAB, suppressing the metastasis inhibitor NDRG1 .

  • Key data:

    • CLDN2 knockout in HT-29 cells reduced liver metastatic burden by 2.37-fold .

    • PDZ-binding domain deletion attenuated metastasis by disrupting ZONAB nuclear shuttling .

Inflammatory Bowel Disease (IBD) and Colitis

  • Dual role: CLDN2 overexpression exacerbates T cell-mediated colitis but protects against chemical/infectious colitis .

  • Permeability effects:

    • CLDN2 knockout reduced sepsis-induced intestinal pore pathway permeability (creatinine flux ↓) .

    • Transgenic CLDN2 increased unrestricted pathway permeability (70-kDa dextran flux ↑) in immune-mediated colitis .

Calcium Transport Regulation

  • Functional assay: Overexpression in Caco-2 cells enhanced transepithelial Ca²⁺ transport by 1.9-fold, dependent on tight junction integrity .

Limitations and Considerations

  • Tag interference: His/GST tags may alter ion selectivity in functional assays .

  • Species specificity: Mouse CLDN2 shares 89% homology with human CLDN2, necessitating cross-reactivity validation in translational studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Cldn2; Claudin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Cldn2
Target Protein Sequence
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
Uniprot No.

Target Background

Function
Claudin-2 plays a critical role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References Into Functions
  1. Research indicates that IL-22 increases intestinal epithelial permeability by upregulating Claudin-2 expression through the JAK/STAT pathway. PMID: 28939759
  2. Claudin-2-null mice exhibit similar sodium conservation to wild-type mice, even under severe dietary sodium depletion. This is due to the upregulation of transcellular Na-K-2Cl transport activity in the thick ascending limb of Henle. PMID: 27214555
  3. Using the tight junction patch clamp technique, researchers identified mouse Claudin-2 ion channel opening events in MDCK cells. PMID: 28605031
  4. A recent study unveils a significant and novel mechanism for VDR by regulating epithelial barriers. PMID: 26212084
  5. Findings demonstrate a crucial, albeit complex, role of Claudin-2 in intestinal homeostasis by regulating epithelial permeability, inflammation, and proliferation. PMID: 24670427
  6. Based on studies of Cldn2(-/-) mice, Claudin 2 regulates paracellular ion and water flow, essential for proper regulation of bile composition and flow. PMID: 25068494
  7. IL-6 modulation of intestinal TJ permeability is regulated by JNK activation of AP-1 and AP-1 activation of the Claudin-2 gene. PMID: 24662742
  8. A comprehensive cysteine-scanning mutagenesis of the entire first extracellular loop (ECL1) of Claudin-2 mapped out all the pore-lining residues. PMID: 24436330
  9. The study found that the capacity for non-AQP1-dependent transcellular proximal fluid reabsorption (PFR) is sufficient to be maintained in AQP1- and Claudin-2-doubly deficient knockout mice. PMID: 24049145
  10. These results suggest that the ERK pathway positively regulates Claudin-2 protein expression and that Claudin-2 is involved in lowering TER in CMT93-II cells. PMID: 23369528
  11. Claudin-2 plays a significant role in colorectal inflammation, implicating the involvement of MLCK in colon inflammation. PMID: 23306855
  12. Cingulin is dispensable for the structure and barrier function of tight junctions, and it is embedded in signaling networks that control the expression of Claudin-2. PMID: 22946046
  13. Data indicate that phosphorylation at S208 plays a significant role in the retention of Claudin-2 at the plasma membrane. PMID: 22825868
  14. STAT6 regulates Claudin-2 induction in oxazolone (OXA) colitis; Claudin-2 staining is increased in wild-type OXA mice but not in STAT6-deficient animals. PMID: 23303670
  15. Claudin-2 is expressed in various epithelial tissues in the cochlea of the inner ear, including the Organ of Corti, stria vascularis, Reissner's membrane, and spiral limbus. PMID: 14698084
  16. During breast cancer liver metastasis, Claudin-2 shifts from functioning within tight-junctional complexes to acting as an adhesion molecule between breast cancer cells and hepatocytes. PMID: 22645303
  17. Abnormal Claudin-2 expression was observed at the plasma membrane of intestinal epithelial cells in adherent-invasive Escherichia coli-infected CEABAC10 mice. PMID: 21688348
  18. Claudin-2 promoter activity is enhanced by IL-6 in a MEK/ERK and PI3K-dependent manner. PMID: 21771795
  19. Claudin 2 is indispensable for paracellular sodium permeability in the small intestine. PMID: 20727355
  20. Claudin-2 was expressed at the base of the glands in the intestine and intestinal metaplasia but not in the body of the stomach. PMID: 20602571
  21. BN-PAGE analysis of mouse liver membrane identified a relatively discrete tight junction structure of a high molecular weight complex containing at least Claudin-1, Claudin-2, and Occludin. PMID: 21098027
  22. Claudin-2 constitutes leaky and cation (Na(+))-selective paracellular channels within tight junctions of mouse proximal tubules. PMID: 20385797
  23. Results support a model where Claudins 2 and 4 create paracellular channels, and the first extracellular domain is sufficient to determine both paracellular charge selectivity and transepithelial electrical resistance. PMID: 12700140
  24. The tail of Claudin-2 could stabilize Claudin-4, leading to a concurrent increase in both protein level and physiological influence. PMID: 15366421
  25. The ERK 1/2 signaling pathway negatively controls Claudin-2 expression in mammalian renal epithelial cells, providing evidence for regulation of tight junction paracellular transport by alterations in Claudin composition within tight junction complexes. PMID: 15569684
  26. Findings strongly suggest that Claudin-2- and/or Claudin-12-based tight junctions form paracellular Ca(2+) channels in intestinal epithelia, highlighting a novel mechanism underlying vitamin D-dependent calcium homeostasis. PMID: 18287530
  27. Molecular basis for cation selectivity in Claudin-2-based pores. PMID: 19538287

Show More

Hide All

Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the kidney, liver and intestine, with higher levels in the ileum than in the jejunum. Low levels in the brain.

Q&A

What is mouse Claudin-2 and what are its key structural characteristics?

Mouse Claudin-2 (Cldn2) is a tight junction protein belonging to the claudin family. It functions as a major integral membrane protein localized exclusively at tight junctions and plays a critical role in regulating paracellular permeability. The protein has a molecular weight of approximately 24.4 kDa and contains 230 amino acid residues . The recombinant form, depending on production system and tags, often appears at around 19.3-25 kDa in SDS-PAGE analysis . Structurally, Claudin-2 is expressed in an organ-specific manner, particularly in the intestine, and regulates tissue-specific physiological properties of tight junctions . The protein contains four transmembrane domains with both N- and C-termini located in the cytoplasm, forming paracellular channels that are cation-selective.

How does recombinant mouse Claudin-2 differ from native Claudin-2?

Recombinant mouse Claudin-2 maintains the core functional domains of native Claudin-2 but typically includes modifications to facilitate purification and detection in experimental settings. The recombinant protein often contains fusion tags such as His-tag, SUMO-tag, GST-tag, or Myc-DYKDDDDK (FLAG) tag . These modifications can affect the apparent molecular weight, with tagged recombinant Claudin-2 appearing larger on SDS-PAGE than predicted (e.g., 25 kDa observed vs. 19.3 kDa predicted) .

The expression systems also differ significantly from native conditions, with recombinant proteins typically produced in:

  • Prokaryotic systems like E. coli (common for partial protein fragments)

  • Eukaryotic systems such as HEK293 cells (for full-length protein with proper folding)

  • Cell-free protein synthesis systems

  • Wheat germ expression systems

Unlike native Claudin-2, recombinant versions may contain only specific regions of interest, such as amino acids 29-81 or 1-230, depending on the experimental requirements .

What expression systems are commonly used for mouse Claudin-2 production, and how do they compare?

Several expression systems are utilized for recombinant mouse Claudin-2 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical ApplicationsProtein Yield
E. coli (prokaryotic)High yield, cost-effective, rapid productionLimited post-translational modifications, partial folding challengesAntibody production, protein fragment studiesHigh
HEK293 cells (mammalian)Proper folding, post-translational modificationsHigher cost, longer production timeFunctional studies, structural analysisModerate
Cell-free protein synthesisRapid production, avoids toxicity issuesLimited scale, higher costDifficult-to-express proteinsLow-Moderate
Wheat germEukaryotic folding without mammalian cell complexitySpecialized equipment neededAlternative to mammalian systemsModerate

For mouse Claudin-2, prokaryotic expression in E. coli is commonly used for producing fragments (amino acids 29-81), yielding proteins with > 90% purity . For applications requiring full-length functional protein, mammalian expression systems like HEK293 cells are preferred, typically achieving > 80% purity as determined by SDS-PAGE .

What are the optimal storage and reconstitution conditions for recombinant mouse Claudin-2?

Proper handling of recombinant mouse Claudin-2 is crucial for maintaining its stability and functionality:

Storage conditions:

  • Recommended storage temperature: -80°C for long-term stability

  • Avoid repeated freeze-thaw cycles (limit to 2-3 cycles)

  • When received as freeze-dried powder, store at -20°C until reconstitution

Reconstitution protocol:

  • Reconstitute in appropriate buffer - typically 20mM Tris, 150mM NaCl (pH 8.0) to a concentration of 0.1-1.0 mg/mL

  • Do not vortex the solution, as this can denature membrane proteins like Claudin-2

  • For working aliquots, thaw samples on ice

  • After initial thawing, immediately aliquot into single-use tubes before re-freezing

Alternative buffer formulations include 25 mM Tris-HCl, pH 7.3, with 100 mM glycine and 10% glycerol for specific applications . For optimal protein stability, addition of stabilizers like trehalose (5%) and surfactants (0.01% SKL) can enhance shelf-life .

How can I validate the purity and activity of recombinant mouse Claudin-2 for my experiments?

A multi-faceted approach ensures proper validation of recombinant mouse Claudin-2:

Purity assessment methods:

  • SDS-PAGE with Coomassie blue staining (expect > 80-90% purity)

  • Western blot using anti-Claudin-2 or anti-tag antibodies

  • Analytical size exclusion chromatography (SEC-HPLC)

Functional validation approaches:

  • Paracellular permeability assays using ion-selective electrodes or fluorescent tracers

  • Electrophysiological measurements in transfected cells

  • Tight junction reconstitution assays

When interpreting SDS-PAGE results, note that the observed molecular weight (≈25 kDa) may differ from the predicted value (≈19.3 kDa) due to factors including:

  • Relative charge contributions from amino acid composition

  • Post-translational modifications

  • Influence of fusion tags

  • Aberrant migration behavior common to membrane proteins

For applications requiring confirmation of selective cation permeability (a key functional characteristic of Claudin-2), assays measuring Na+, methylamine, and ethylamine flux across epithelial monolayers provide quantitative validation .

What experimental controls should be included when working with recombinant mouse Claudin-2?

Positive controls:

  • Wild-type claudin-2 expressing cells or tissues (e.g., intestinal crypts)

  • Previously validated recombinant Claudin-2 protein batch

  • IL-13 treated samples (known to upregulate Claudin-2)

Negative controls:

  • Claudin-2 knockout (Cldn2-/-) cells or tissues

  • Isotype-matched irrelevant protein with similar tag system

  • Buffer-only conditions

Specificity controls:

  • Other claudin family members (e.g., Claudin-14, Claudin-23) to assess selectivity

  • Competitive binding assays with unlabeled protein

  • Tag-only protein constructs to distinguish tag artifacts from Claudin-2 effects

When conducting genetic knockout experiments, validation through ICE (Inference of CRISPR Edits) analysis is recommended, with efficiency values >90% indicating successful Cldn2 gene editing . For transgenic overexpression studies, confirming localization at tight junctions using immunofluorescence microscopy is essential .

How can recombinant mouse Claudin-2 be used to study intestinal barrier function?

Recombinant mouse Claudin-2 serves as a powerful tool for investigating intestinal barrier regulation through several sophisticated approaches:

Barrier reconstitution models:

  • Addition of purified recombinant Claudin-2 to claudin-deficient epithelial cells

  • Integration into artificial lipid bilayers to study channel formation

  • Comparative studies between wild-type and mutant Claudin-2 variants

Molecular interaction studies:

  • Protein-protein interaction assays to identify binding partners

  • Overlay assays using labeled recombinant Claudin-2

  • Pull-down experiments to isolate Claudin-2 complexes

Research has demonstrated that Claudin-2 creates paracellular channels selective for small cations (Na+) and water, with IL-13 treatment increasing Claudin-2 expression and concomitantly enhancing paracellular permeability to Na+, methylamine, and ethylamine in intestinal tissue . This selective permeability can be recapitulated by transgenic expression of GFP-Claudin-2, confirming Claudin-2's direct role in regulating barrier function .

Interestingly, Claudin-2 effects on barrier function appear context-dependent: in infectious and chemical colitis models, Claudin-2 knockout augments disease severity, while overexpression is protective. This contrasts with immune-mediated colitis, where transgenic Claudin-2 expression exacerbates disease . These findings suggest that Claudin-2-mediated pore pathway permeability may represent an adaptive response in some inflammatory contexts but be detrimental in others.

What is known about Claudin-2's role in cancer progression, and how can recombinant protein help study these mechanisms?

Claudin-2 has emerged as a significant regulator in cancer biology, particularly in colorectal cancer (CRC):

Key findings on Claudin-2 in cancer:

  • High Claudin-2 expression correlates with decreased cancer-specific survival in CRC patients

  • Claudin-2 promotes CRC development and metastasis by inhibiting NDRG1 transcription

  • Claudin-2 affects cancer cell growth and migration/invasion via EGFR-mediated signaling transactivation

  • High Claudin-2 expression is associated with worse prognosis and increased recurrence risk in stage II/III CRC patients receiving adjuvant treatment

Research applications of recombinant Claudin-2:

  • Structure-function studies using domain-specific mutants

  • Signaling pathway analysis in cancer cells

  • Development of blocking agents targeting Claudin-2 interactions

CRISPR/Cas9-mediated knockout of Claudin-2 in HCT116 colon cancer cells revealed widespread downregulation of genes linked to motility, invasion, and metastasis, including ZONAB, NDRG1, Claudin-14, Claudin-23, Bcl2, P53, and BCL-6 . This suggests that Claudin-2 functions as a master regulator of multiple pathways involved in cancer progression. Recombinant Claudin-2 can be used to rescue expression in knockout cells, allowing precise determination of structure-function relationships and identification of critical domains responsible for these oncogenic effects.

How can recombinant mouse Claudin-2 be used for developing targeted therapeutics?

The involvement of Claudin-2 in intestinal barrier function and cancer progression makes it an attractive therapeutic target:

Target validation approaches:

  • Epitope mapping using truncated recombinant Claudin-2 fragments

  • Competition assays with extracellular loop-derived peptides

  • High-throughput screening of compound libraries against recombinant Claudin-2

Therapeutic development strategies:

  • Claudin-2 channel blockers for treating barrier dysfunction

  • Claudin-2 expression modulators for cancer therapy

  • Anti-Claudin-2 antibody development for targeted delivery

The dual and seemingly contradictory roles of Claudin-2 in different disease contexts require careful consideration when developing therapeutics. In infectious and chemical colitis, increasing Claudin-2 function may be beneficial, while in immune-mediated colitis and cancer, inhibition appears more promising .

For antibody development, recombinant mouse Claudin-2 with >80% purity is suitable for immunization protocols and for screening antibody specificity . The availability of various tagged versions (His-tag, SUMO-tag, GST-tag) facilitates different purification and detection strategies during therapeutic development .

How do mouse and human Claudin-2 compare, and what are the implications for translational research?

Understanding species differences is crucial for translating mouse-based findings to human applications:

Structural and functional comparisons:

FeatureMouse Claudin-2Human Claudin-2Implications
Amino acid identityReference~84% identity to mouseHigh conservation suggests similar functions
Expression patternIntestinal crypts, proximal tubulesSimilar to mouse, with some tissue-specific differencesContext-dependent interpretation needed
Channel propertiesCation-selective, water permeableSimilar selectivity profileConserved pore function
RegulationIL-13 responsiveIL-13 responsive, possibly additional regulatorsShared inflammatory pathways
Disease associationsRole in colitis models, variable outcomesUpregulated in IBD, cancerComplex, context-dependent functions

Despite high conservation, species differences necessitate validation of mouse findings in human systems. Experimental approaches include:

  • Comparative functional studies with recombinant proteins from both species

  • Cross-species rescue experiments in knockout models

  • Parallel analysis of transgenic mice expressing human Claudin-2

In colitis models, both mouse and human Claudin-2 transgenic expression appears protective in chemical (DSS) colitis but potentially harmful in immune-mediated colitis , suggesting conserved functional roles in inflammatory contexts.

What transgenic and knockout mouse models are available for studying Claudin-2 function?

Several genetic mouse models have been developed to investigate Claudin-2 function in vivo:

Knockout models:

  • Cldn2-/- (complete knockout) - Shows delayed onset of immune-mediated colitis but increased risk of intestinal obstruction

  • Tissue-specific conditional knockouts - Allow investigation of Claudin-2 function in specific cell types

Transgenic models:

  • Cldn2 Tg (overexpression using Vil1 promoter) - Exhibits intestinal epithelium-specific expression of GFP-tagged Claudin-2

  • Inducible transgenic models - Permit temporal control of Claudin-2 expression

Compound genetic models:

  • Cldn2-/-Rag1-/- - Used to study immune-mediated colitis in the absence of Claudin-2

  • Cldn2 TgRag1-/- - Allows investigation of Claudin-2 overexpression in immune-deficient backgrounds

These models have revealed complex, context-dependent roles for Claudin-2. In infectious and chemical colitis, Claudin-2 knockout exacerbated disease while overexpression was protective . Conversely, in immune-mediated colitis (T cell transfer model), transgenic Claudin-2 expression unexpectedly worsened disease outcomes . The recombinant protein can be used for rescue experiments in knockout models to confirm specificity of observed phenotypes.

How can cell-based assays be optimized using recombinant mouse Claudin-2?

Cell-based experimental systems provide controlled environments for investigating Claudin-2 function:

Cell line selection considerations:

  • Endogenous Claudin-2 expression levels

  • Presence of tight junction machinery

  • Polarization capacity

  • Transfection efficiency

Optimization strategies for recombinant Claudin-2 studies:

  • Titration of recombinant protein concentration (typically 0.1-1.0 mg/mL)

  • Adjustment of exposure time to determine acute vs. chronic effects

  • Co-application with cytokines (e.g., IL-13) to modulate endogenous expression

  • Combination with other tight junction proteins to study complex barrier regulation

Advanced cell-based applications:

  • CRISPR/Cas9-mediated knockout followed by rescue with recombinant protein

  • Structure-function analysis using domain-specific mutants

  • Real-time imaging of barrier dynamics using labeled recombinant Claudin-2

The CRISPR/Cas9 system has been effectively used to create claudin-2 knockout in HCT116 colon cancer cells with high editing efficiency (91% INDL) . These edited cell lines, when compared to wild-type cells, revealed widespread downregulation of genes associated with cancer progression, including ZONAB, NDRG1, Claudin-14, and Claudin-23 .

Why might recombinant mouse Claudin-2 show different molecular weights in various experimental systems?

Discrepancies in observed molecular weight are common with membrane proteins like Claudin-2:

Common causes of molecular weight variations:

  • Fusion tags influence: His-tag, SUMO-tag, GST-tag, or Myc-DYKDDDDK Tag can add significant mass to the protein

  • Post-translational modifications: Especially in eukaryotic expression systems

  • Protein-detergent complexes: Residual detergent binding can alter migration

  • Relative charge effects: Amino acid composition affects SDS binding and mobility

  • Conformational resistance: Incomplete denaturation of transmembrane domains

For recombinant mouse Claudin-2, the predicted molecular mass is often around 19.3 kDa, but the actual observed mass on SDS-PAGE under reducing conditions is approximately 25 kDa . This discrepancy is normal and expected due to the factors listed above.

When comparing different batches or sources of recombinant Claudin-2, standardization of electrophoresis conditions and marker systems is critical for consistent molecular weight determination. Western blotting with specific antibodies against either Claudin-2 or the fusion tag provides confirmation of protein identity despite migration anomalies.

What are the most common pitfalls when using recombinant mouse Claudin-2 in barrier function studies?

Several technical challenges can affect experiments investigating Claudin-2's role in barrier function:

Common pitfalls and solutions:

ChallengePotential CausesRecommended Solutions
Lack of functional effectImproper folding of recombinant proteinUse eukaryotic expression systems (HEK293) for full-length protein
Insufficient incorporation into tight junctionsVerify localization by immunofluorescence
Compensatory mechanisms in experimental systemConsider combinatorial knockout approaches
Inconsistent barrier measurementsVariability in cell density or culture conditionsStandardize seeding density and TEER measurements
Batch-to-batch protein variationInclude internal standards and positive controls
Environmental factors (temperature, pH)Control environmental conditions rigorously
Non-specific effectsTag interference with functionCompare different tag positions or use tag-removal strategies
Contaminants in preparationVerify purity (>80-90%) by multiple methods
Endotoxin presence from bacterial expressionInclude endotoxin testing for E. coli-derived proteins

For accurate barrier function assessment, transgenic expression models that recapitulate physiological Claudin-2 distribution patterns often provide more reliable results than exogenous protein application . When using recombinant protein, careful titration studies should establish dose-response relationships.

How can I address reproducibility issues in Claudin-2 protein expression and purification?

Ensuring consistent production of functional recombinant mouse Claudin-2 requires attention to several critical factors:

Key reproducibility considerations:

  • Expression system standardization

    • Maintain consistent cell passage numbers for mammalian expression

    • Use the same E. coli strain and growth conditions for prokaryotic expression

    • Document and control induction parameters (temperature, time, inducer concentration)

  • Purification protocol optimization

    • Standardize buffer compositions (20mM Tris, 150mM NaCl, pH8.0)

    • Validate tag-based purification efficiency batch-to-batch

    • Implement quality control checkpoints throughout the purification process

  • Storage and stability protocols

    • Aliquot purified protein to avoid freeze-thaw cycles

    • Store at recommended temperature (-80°C long-term)

    • Include stabilizers (5% trehalose, 0.01% SKL) for lyophilized preparations

  • Validation metrics

    • Establish acceptance criteria for purity (typically >80-90% by SDS-PAGE)

    • Develop functional assays specific to Claudin-2 activity

    • Document protein concentration determination methods

Prokaryotic expression of partial Claudin-2 fragments (e.g., amino acids 29-81) typically yields higher quantities of protein but may lack proper folding for some applications . For studies requiring full functional activity, mammalian expression systems producing full-length Claudin-2 (amino acids 1-230) are preferred despite potentially lower yields .

How is recombinant Claudin-2 being used to explore its role in inflammatory bowel disease pathogenesis?

Recent research has uncovered complex roles for Claudin-2 in intestinal inflammation:

Key findings in inflammatory bowel disease models:

  • Claudin-2 has context-dependent effects in different colitis models

  • Protective in infectious (Citrobacter rodentium) and chemical (DSS) colitis

  • Detrimental in immune-mediated (T cell transfer) colitis models

  • Claudin-2 knockout leads to delayed disease onset in immune-mediated colitis

  • Transgenic Claudin-2 expression exacerbates immune-mediated colitis

Current research applications:

  • Investigating disease-specific Claudin-2 regulation in different IBD subtypes

  • Exploring Claudin-2's role in epithelial repair and regeneration

  • Examining interactions between Claudin-2 and immune cell populations

Studies using Cldn2-/-Rag1-/- and Cldn2 TgRag1-/- mice have revealed that Claudin-2 differentially affects inflammatory outcomes in immune-mediated colitis. Disease was significantly more severe in Cldn2 TgRag1-/- mice compared to Cldn2+/+Rag1-/- controls, with greater weight loss, higher disease activity scores, and increased permeability to both small and large molecules . Conversely, Cldn2-/- mice showed delayed disease onset and reduced inflammatory cytokine production . These findings suggest that while Claudin-2 upregulation may be adaptive in some inflammatory contexts, it appears detrimental in T cell-mediated inflammation.

What new techniques are being developed to study Claudin-2 protein-protein interactions?

Advances in molecular techniques are expanding our understanding of Claudin-2's interaction network:

Emerging methodologies:

  • Proximity labeling techniques (BioID, APEX) to identify claudin-2 interactors in living cells

  • Single-molecule tracking of fluorescently labeled recombinant Claudin-2

  • Cryo-electron microscopy for structural analysis of Claudin-2 complexes

  • High-throughput interactome mapping using protein arrays with recombinant Claudin-2

Recent findings:

  • Claudin-2 interactions with ZONAB affect gene expression in cancer progression

  • Claudin-2 inhibits NDRG1 transcription, promoting CRC development and metastasis

  • Claudin-2 may interact with or regulate other claudin family members (Claudin-14, Claudin-23)

CRISPR/Cas9-mediated knockout of Claudin-2 in HCT116 cells revealed its regulatory influence on multiple genes associated with cancer progression, including ZONAB, NDRG1, Claudin-14, Claudin-23, Bcl2, P53, and BCL-6 . These findings suggest Claudin-2 functions not only as a structural tight junction protein but also as a signaling hub affecting transcriptional networks. Recombinant Claudin-2 protein is being used to validate direct interaction partners and to identify the specific domains responsible for these regulatory effects.

How might recombinant Claudin-2 contribute to development of targeted therapies for colorectal cancer?

The involvement of Claudin-2 in colorectal cancer progression presents therapeutic opportunities:

Therapeutic development approaches:

  • Target validation strategies

    • Using recombinant Claudin-2 to screen for small molecule inhibitors

    • Developing neutralizing antibodies against specific Claudin-2 domains

    • Testing peptide mimetics that disrupt Claudin-2 protein-protein interactions

  • Precision medicine applications

    • Correlating Claudin-2 expression levels with treatment responses

    • Identifying patient subgroups that might benefit from Claudin-2-targeted therapies

    • Developing companion diagnostics using anti-Claudin-2 antibodies

  • Combination therapy exploration

    • Testing Claudin-2 inhibitors with established chemotherapeutics

    • Investigating synergistic effects with immune checkpoint inhibitors

    • Exploring interactions with radiation therapy

High Claudin-2 expression correlates with decreased cancer-specific survival rates and worse prognosis in stage II/III CRC patients receiving adjuvant treatment . CRISPR-mediated Claudin-2 knockout in colon cancer cells leads to downregulation of multiple genes associated with motility, invasion, and metastasis , suggesting that targeting Claudin-2 could simultaneously affect multiple cancer-promoting pathways. These findings position Claudin-2 as a promising therapeutic target for CRC, with recombinant protein serving as a valuable tool for drug discovery and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.