Recombinant Mouse Claudin domain-containing protein 2 (Cldnd2)
Shipped with Ice Packs 
In Stock 
Description
Production and Availability
Recombinant mouse Cldnd2 is commercially available in multiple formats:
Table 1: Recombinant Mouse Cldnd2 Products
*Pricing estimates based on industry standards for recombinant proteins .
Table 2: Key Experimental Uses
Challenges and Opportunities
-
Specificity: Antibodies against Cldnd2 require rigorous validation due to homology with other claudins .
-
Therapeutic Potential: While claudin-2 fusion proteins show promise in HIV neutralization , Cldnd2’s role in disease remains underexplored.
-
Tool Development: The AAV-Cldnd2 vector (serotype-dependent) facilitates gene delivery but requires optimization for target tissues .
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cldnd2; Claudin domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cldnd2
Target Protein Sequence
MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVA
VSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAW
KPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL
Uniprot No.
Target Background
Database Links
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
