Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Coiled-coil Domain-containing Protein 109B (Ccdc109b)

Recombinant Mouse Coiled-coil Domain-containing Protein 109B (Ccdc109b), also known as Mitochondrial Calcium Uniporter Regulatory Subunit MCUb, is a protein that plays a crucial role in regulating mitochondrial calcium uptake. This protein is part of the mitochondrial calcium uniporter complex, which is essential for maintaining mitochondrial function and calcium homeostasis within cells.

Structure and Function

Ccdc109b acts as a regulatory subunit of the mitochondrial calcium uniporter (MCU), which is a channel responsible for mediating calcium uptake into the mitochondrial matrix . The MCU complex is critical for various cellular processes, including energy metabolism and cell signaling. Ccdc109b, specifically, functions as a dominant negative regulator, modulating the activity of the MCU by reducing its calcium uptake capacity .

Research Findings

Recent studies have highlighted the role of Ccdc109b in cancer, particularly in gliomas. Elevated expression of Ccdc109b has been observed in high-grade gliomas (HGG), suggesting its potential as an oncogene and prognostic marker . The protein's involvement in hypoxia-induced glioma cell migration and invasion further underscores its significance in tumor progression .

Recombinant Protein Production

Recombinant Mouse Ccdc109b is produced using various expression systems, including cell-free expression, E. coli, yeast, baculovirus, or mammalian cells . The purity of the recombinant protein is typically greater than or equal to 85%, as determined by SDS-PAGE .

Table 2: Recombinant Ccdc109b Production Details

Host SystemPurityApplications
Cell-free Expression≥85%Research studies
E. coli≥85%Large-scale production
Yeast≥85%Biotechnological applications
Baculovirus≥85%High-level expression
Mammalian Cells≥85%Complex protein production

Applications and Future Directions

The recombinant Ccdc109b protein is primarily used in research settings to study its role in mitochondrial function and cancer biology. Its applications include ELISA, immunohistochemistry, and functional assays to investigate its regulatory effects on the MCU complex . Future studies may explore its potential as a therapeutic target for gliomas and other cancers where Ccdc109b is overexpressed.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mcub; Ccdc109b; Calcium uniporter regulatory subunit MCUb, mitochondrial; MCUb; Coiled-coil domain-containing protein 109B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mcub
Target Protein Sequence
MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHY GTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAA IITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRL FTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQ GGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKK SQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGEEASEKN
Uniprot No.

Target Background

Function
Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b) negatively regulates the activity of the mitochondrial calcium uniporter (MCU), thereby modulating calcium uptake into the mitochondria. It does not independently form functional calcium channels. Mitochondrial calcium homeostasis is critical for cellular physiology, regulating cellular bioenergetics, cytoplasmic calcium signaling, and the activation of cell death pathways.
Gene References Into Functions
  1. Functional characterization of the MCUb protein demonstrates its inhibitory effect on mitochondrial calcium uptake. PMID: 23900286
Database Links
Protein Families
MCU (TC 1.A.77) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in lung, brain and heart, and at lower levels in white fat, skeletal muscle and spleen. Detected at very low levels in kidney and liver.

Q&A

What is the molecular structure and subcellular localization of CCDC109B?

CCDC109B contains a coiled-coil domain structural motif and two predicted transmembrane domains. It was first identified as a paralogue of the Mitochondrial Calcium Uniporter (MCU) . The protein primarily localizes to the inner mitochondrial membrane (IMM) where it plays a role in facilitating Ca²⁺ flux. Immunofluorescence studies have confirmed its expression pattern, showing differential distribution between normal human astrocytes and glioma cells .

Methodologically, researchers can visualize CCDC109B distribution using confocal microscopy with cells fixed with 4% paraformaldehyde, permeabilized with 0.5% Triton X-100, and stained with primary antibody against CCDC109B (1:100) followed by incubation with Alexa Fluor 594 goat anti-rabbit IgG (1:800) .

How does CCDC109B function in normal cellular processes?

In normal cells, CCDC109B acts as a dominant negative mediator of MCU, attenuating mitochondrial calcium increases evoked by agonist stimulation. This regulation of calcium homeostasis is crucial for mitochondrial function and cellular metabolism . Experimental approaches to study this function include calcium flux assays and mitochondrial function assessments.

The protein's normal physiological roles include:

  • Regulation of mitochondrial Ca²⁺ levels

  • Maintenance of mitochondrial membrane potential

  • Potential influence on cellular energy metabolism

  • Modulation of cellular response to environmental stressors

What experimental techniques are most reliable for measuring CCDC109B expression levels?

For quantifying CCDC109B expression, multiple complementary approaches should be employed:

  • Western blot analysis: Protein isolation using RIPA buffer containing protein inhibitor cocktail, followed by SDS-PAGE separation and transfer to PVDF membranes. Primary antibody against CCDC109B at 1:500 dilution provides reliable results .

  • qRT-PCR: For mRNA quantification, with appropriate housekeeping gene controls.

  • Immunohistochemistry (IHC): For tissue sections, allowing assessment of expression patterns across different regions of tissue samples .

  • Immunofluorescence (IF): For subcellular localization studies, particularly valuable for co-localization experiments .

For validation, cross-referencing results with public databases (TCGA, CGGA, and GEO) is recommended for comparative analysis.

What are the most effective approaches for CCDC109B knockdown in experimental systems?

Based on experimental validation, lentiviral-mediated shRNA delivery provides consistent and stable CCDC109B knockdown. Three different shRNAs targeting CCDC109B have been tested, with sh-CCDC109B-1 demonstrating nearly complete protein depletion, making it optimal for functional studies .

Experimental protocol details:

  • Design multiple shRNA sequences targeting different regions of CCDC109B mRNA

  • Package into lentiviral vectors for stable integration

  • Verify knockdown efficiency by qRT-PCR and western blot analysis

  • For in vivo studies, establish stable cell lines before implantation

Alternative approaches include siRNA for transient knockdown, particularly useful in hypoxia-related experiments where HIF1α and CCDC109B relationships are being investigated .

How can researchers effectively model hypoxia-induced changes in CCDC109B expression?

Hypoxia significantly affects CCDC109B expression, making it an important experimental variable. The recommended protocol includes:

  • Culture cells in a hypoxic chamber (1% O₂, 5% CO₂, 94% N₂) for 24-48 hours

  • For pharmacological hypoxia induction, treat cells with cobalt chloride (CoCl₂, 100-200 μM)

  • Verify hypoxic conditions by measuring HIF1α expression

  • Compare CCDC109B expression between normoxic and hypoxic conditions using western blot and qRT-PCR

For in vivo studies, administration of HIF1α inhibitors such as digoxin (2 mg/kg daily by intraperitoneal injection) can be used to modulate the hypoxic response and subsequently CCDC109B expression .

What cell and animal models provide the most relevant systems for studying CCDC109B in glioma?

Cell models:

  • U87MG and U251 human glioma cell lines have been validated for CCDC109B functional studies

  • These cell lines demonstrate measurable CCDC109B expression and respond to both genetic manipulation and hypoxic conditions

  • Normal human astrocytes serve as appropriate controls

Animal models:

How does CCDC109B expression correlate with glioma grade and patient prognosis?

CCDC109B expression shows a strong correlation with glioma grade and patient outcomes:

Expression by tumor grade:

  • High-grade gliomas (WHO III-IV): 59.2% (29/49) high expression

  • Low-grade gliomas (WHO I-II): 10.5% (2/19) high expression

  • Normal brain tissue: Minimal expression

Prognosis correlation:

What molecular mechanisms underlie CCDC109B's role in glioma cell invasion and migration?

CCDC109B influences glioma invasion and migration through multiple mechanisms:

  • Regulation of matrix metalloproteinases: CCDC109B knockdown reduces MMP2 and MMP9 expression, crucial mediators of extracellular matrix degradation during invasion .

  • Hypoxia-mediated invasion: CCDC109B is a critical factor in mediating HIF1α-induced glioma cell migration and invasion. Knockdown of CCDC109B significantly attenuates hypoxia-enhanced invasion and migration .

  • Mesenchymal phenotype association: CCDC109B expression is significantly elevated in the mesenchymal molecular subtype of glioma, which is characterized by enhanced invasive properties .

Experimental Transwell migration and invasion assays have quantitatively demonstrated that CCDC109B knockdown reduces the number of migrating/invading cells by approximately 50-60% in both U87MG and U251 cell lines .

What is the relationship between hypoxia, HIF1α, and CCDC109B expression?

The relationship between hypoxia and CCDC109B has been well-established:

  • CCDC109B expression is significantly elevated in necrotic/hypoxic areas of glioma tissue samples .

  • In vitro hypoxia (1% O₂) induces CCDC109B expression at both mRNA and protein levels in a time-dependent manner, with peak expression after 24 hours of hypoxic exposure .

  • HIF1α appears to be a direct transcriptional regulator of CCDC109B:

    • siRNA-mediated knockdown of HIF1α reduces CCDC109B expression

    • Pharmacological inhibition of HIF1α using specific inhibitors (YC-1 or digoxin) decreases CCDC109B expression both in vitro and in vivo

    • In vivo digoxin treatment (2 mg/kg) significantly reduces both tumor size and CCDC109B expression in xenograft models

This regulatory relationship suggests that CCDC109B may be an important downstream effector of hypoxia-induced changes in glioma progression.

How might CCDC109B serve as a therapeutic target in glioma treatment?

CCDC109B presents several attributes of a promising therapeutic target:

The research suggests that CCDC109B targeting may be particularly valuable in hypoxic tumors, which are often more resistant to conventional therapies.

What research gaps remain in understanding CCDC109B's role in brain tumors?

Despite significant progress, several key questions remain:

  • Precise molecular mechanisms: How does CCDC109B influence mitochondrial calcium handling in glioma cells, and how does this connect to proliferation and invasion?

  • Interaction partners: The complete interactome of CCDC109B in glioma cells remains to be elucidated.

  • Genetic and epigenetic regulation: Beyond HIF1α, what other factors regulate CCDC109B expression?

  • Relationship to treatment resistance: Preliminary data suggest CCDC109B may contribute to temozolomide resistance, but mechanisms remain unclear .

  • Therapeutic targeting: No specific CCDC109B inhibitors have been developed or tested.

Future research should employ multi-omics approaches, detailed structure-function analysis, and development of more sophisticated in vivo models to address these questions.

How does CCDC109B expression vary across glioma molecular subtypes?

CCDC109B shows distinct expression patterns across different molecular subtypes of glioma:

Molecular SubtypeCCDC109B ExpressionStatistical Significance
MesenchymalHighestP < 0.001
ClassicalIntermediate-
NeuralLower-
ProneuralLower-

This pattern has been consistently observed across multiple datasets (TCGA, CGGA, GSE4271) . The association with the mesenchymal subtype is particularly interesting as this subtype is typically associated with more aggressive behavior and poorer outcomes.

The elevated expression in mesenchymal gliomas suggests that CCDC109B may play a role in the mesenchymal transition process or in maintaining mesenchymal characteristics, further supporting its potential role in invasion and migration.

What are the common challenges in CCDC109B protein detection and quantification?

Researchers commonly encounter several technical challenges when studying CCDC109B:

  • Antibody specificity: Due to structural similarities with other coiled-coil domain proteins, antibody cross-reactivity can occur. Validation using positive and negative controls is essential.

  • Mitochondrial protein extraction: As CCDC109B localizes to mitochondria, standard protein extraction protocols may not be optimal. Specialized mitochondrial isolation procedures may improve detection.

  • Protein stability: Attention to sample handling and processing time is critical for accurate quantification.

Best practices include:

  • Using standardized protein extraction protocols with RIPA buffer containing protease inhibitors

  • Processing samples rapidly at 4°C

  • Including appropriate controls (knockdown samples as negative controls)

  • Validating antibodies using multiple detection methods

How can researchers effectively design functional studies to investigate CCDC109B's role in specific cellular processes?

For comprehensive functional characterization of CCDC109B, consider these methodological approaches:

  • Gene manipulation strategies:

    • Use multiple shRNA/siRNA sequences to control for off-target effects

    • Complement knockdown studies with rescue experiments

    • Consider inducible systems for temporal control of expression

  • Comprehensive functional assays:

    • Proliferation: EdU incorporation and colony formation assays

    • Migration/invasion: Transwell assays with/without matrigel coating

    • Calcium signaling: Fluorescent calcium indicators to measure mitochondrial calcium flux

    • In vivo studies: Both orthotopic and subcutaneous xenograft models

  • Contextual factors to consider:

    • Oxygen levels: Compare normoxic vs. hypoxic conditions

    • Growth factors: Examine interactions with tumor microenvironment signals

    • Drug treatments: Assess impact on treatment response

  • Data validation:

    • Use multiple cell lines (minimum of two distinct glioma lines)

    • Validate key findings in patient-derived primary cultures

    • Correlate in vitro findings with patient data from public databases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.