Recombinant Mouse Coiled-coil domain-containing protein 51 (Ccdc51)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Mouse Coiled-coil domain-containing protein 51 (Ccdc51) is a protein that, in humans, is encoded by the CCDC51 gene . CCDC51 belongs to the family of proteins containing coiled-coil domains (CCDCs), which participate in cell growth and development, including regulation of gene expression and drug sensitivity . CCDC51 may also be referred to as Mitok, Mitochondrial potassium channel, or Coiled-coil domain-containing protein 51 .

Basic Information

CategoryDescription
Gene NameCcdc51
SynonymsCcdc51; Mitok; Mitochondrial potassium channel; MITOK; Coiled-coil domain-containing protein 51
SpeciesMus musculus
SourceE. coli
Protein LengthFull Length (1-406aa)
AA SequenceMTGCSPVFAMQHVVGVPRILVRRTFLGTDVTMTRTLCSPGPREKRPEAAALGLFHRLPELGRTLSHTVRHQAASTAKAWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAREGLEAQQTKLKEVRDRLDRVSREDNQYLELATLEHRMLQEEKRLRIAYLRAEDSEREKFSLFSAAVRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKGPASLQEAIREQASSYSLQQKDLQDLMMDLRGLVHAEQGQGSGSPTGSSTRGKDIDGLSATMKEQLRHSRQVYSCLEGLREQLDGLEKTCSQMAGVLQLAQAPAHPGTVGPVDGALPSSLLEHGSVILALSEMEQRLEAQANRNTVSSTLVTCVTFLATLPLLYMLFKTS

Expression and Function

CCDC51 is differentially expressed in various cancers . CCDC51 expression was found to be increased in breast invasive carcinoma (BRCA), cholangiocarcinoma (CHOL), cancer of the cervical squamous cell and endocervical adenocarcinoma (CESC), bladder urothelial carcinoma (BLCA), glioblastoma multiforme (GBM), head and neck squamous cell carcinoma (HNSC), colon adenocarcinoma (COAD), liver hepatocellular carcinoma (LIHC), esophageal carcinoma (ESCA), kidney renal papillary cell carcinoma (KIRP), prostate adenocarcinoma (PRAD), lung adenocarcinoma (LUAD), lung squamous cell carcinoma (LUSC), rectum adenocarcinoma (READ), uterine corpus endometrial carcinoma (UCEC) and stomach adenocarcinoma (STAD) tissues compared with adjacent normal tissues . Furthermore, CCDC51 expression was low in kidney renal clear cell carcinoma (KIRC), kidney chromophobe (KICH), and thyroid carcinoma .

CCDC51 is involved in mitochondrial dynamics. Depletion of CCDC51 reduces mitochondrial fission rates, contributing to morphological defects in cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
Ccdc51; Mitok; Mitochondrial potassium channel; MITOK; Coiled-coil domain-containing protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ccdc51
Target Protein Sequence
MTGCSPVFAMQHVVGVPRILVRRTFLGTDVTMTRTLCSPGPREKRPEAAALGLFHRLPEL GRTLSHTVRHQAASTAKAWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAREGL EAQQTKLKEVRDRLDRVSREDNQYLELATLEHRMLQEEKRLRIAYLRAEDSEREKFSLFS AAVRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKGPAS LQEAIREQASSYSLQQKDLQDLMMDLRGLVHAEQGQGSGSPTGSSTRGKDIDGLSATMKE QLRHSRQVYSCLEGLREQLDGLEKTCSQMAGVLQLAQAPAHPGTVGPVDGALPSSLLEHG SVILALSEMEQRLEAQANRNTVSSTLVTCVTFLATLPLLYMLFKTS
Uniprot No.

Target Background

Function

Recombinant Mouse Coiled-coil domain-containing protein 51 (Ccdc51) is a mitochondrial potassium channel residing in the inner mitochondrial membrane. In conjunction with ABCB8/MITOSUR, it forms a mitochondrial protein complex that facilitates ATP-dependent potassium ion transport across the inner membrane (the mitoK(ATP) channel). Ccdc51 may contribute to the homeostatic regulation of cellular metabolism under stress conditions by modulating mitochondrial matrix volume.

Database Links
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is mouse Ccdc51 and how is it functionally related to homologs in other species?

Mouse Ccdc51 is a coiled-coil domain-containing protein localized to the inner mitochondrial membrane (IMM). Functionally, it serves as a mediator of mitochondrial morphology and plays a crucial role in mitochondrial fission dynamics . While early bioinformatic analyses didn't identify obvious homologs across diverse species, recent research has revealed that human CCDC51 (also called MITOK) and yeast Mdm33 are functionally conserved proteins despite limited sequence homology .

To study evolutionary conservation experimentally, researchers have successfully demonstrated that human CCDC51 can partially rescue mitochondrial morphology defects in yeast Δmdm33 cells, confirming these proteins are functional orthologs . This functional conservation suggests that the role of these proteins in mitochondrial dynamics is evolutionarily important, despite sequence divergence.

What is the precise subcellular localization of Ccdc51 within mitochondria?

Ccdc51 is specifically localized to the inner mitochondrial membrane (IMM), where it functions as an integral membrane protein . Detailed localization studies using fluorescently tagged proteins reveal that while Ccdc51 generally distributes throughout mitochondria, it can concentrate at discrete foci that are spatially and temporally linked to mitochondrial fission events .

When studying Ccdc51 localization, researchers should employ co-localization experiments with established markers for different mitochondrial compartments. For example, using mCherry-OMP25 for the outer mitochondrial membrane (OMM), TIMM50-GFP for the IMM, and matrix markers like mito-HaloTag labeled with appropriate fluorophores (e.g., JF646) will allow precise determination of Ccdc51's spatial distribution . In cells with normal Ccdc51 expression, these markers typically show relatively uniform distribution, while Ccdc51-depleted cells exhibit distinct localization patterns across compartments .

How does Ccdc51 influence mitochondrial fission dynamics?

Ccdc51 functions as a positive effector of Drp1-mediated mitochondrial fission . Mechanistically, Ccdc51 appears to demarcate potential fission sites on the inner mitochondrial membrane and facilitates the fission process. Loss of Ccdc51 leads to several observable phenotypes that reveal its role:

  • Mitochondrial hyperfusion occurs following Ccdc51 depletion

  • Reduced mitochondrial fission rates (approximately 32% less frequent compared to control cells)

  • Delayed response to stress-induced mitochondrial fragmentation

  • Development of distinctive lamellar mitochondrial morphology in Ccdc51-depleted cells

Importantly, while Ccdc51 promotes fission, its depletion does not completely abolish fission events, suggesting it works in concert with other fission machinery or is required for only a subset of fission events .

What are effective approaches to manipulate Ccdc51 expression for functional studies?

Researchers can employ several complementary approaches to modulate Ccdc51 expression:

  • RNA interference (siRNA): For acute depletion studies, siRNA targeting Ccdc51 effectively reduces protein levels and rapidly induces mitochondrial hyperfusion phenotypes . This approach is suitable for examining immediate consequences of Ccdc51 loss.

  • CRISPR interference (CRISPRi): For stable and potentially more specific knockdown, CRISPRi targeting Ccdc51 creates a more sustained depletion model . Studies show this method produces a milder phenotype than acute siRNA depletion (32% reduction in fission rates versus more severe effects with siRNA) .

  • Overexpression systems: Transient expression of tagged Ccdc51 (such as GFP-CCDC51) allows gain-of-function studies and mutational analyses . Importantly, overexpression promotes spatial association with Drp1 and leads to mitochondrial fragmentation, providing a complementary approach to loss-of-function studies .

When designing rescue experiments, researchers should consider using expression constructs resistant to the knockdown method employed, and carefully titrate expression levels to avoid overexpression artifacts.

How can I effectively visualize and quantify mitochondrial morphology changes in Ccdc51 studies?

To accurately assess mitochondrial morphology alterations:

  • Fluorescent labeling options:

    • MitoTracker staining for live-cell imaging of dynamic events

    • Immunofluorescence for fixed samples using antibodies against TOMM20 (OMM) and HSP60 (matrix)

    • Fluorescently tagged proteins targeting different mitochondrial compartments

  • Quantification approaches:

    • Measure fission event frequency through time-lapse microscopy of MitoTracker-stained cells

    • Categorize mitochondrial morphology phenotypes (tubular, fragmented, lamellar, etc.) across cell populations

    • Compare resistance to stress-induced fragmentation using treatments like BAPTA-AM (a calcium chelator that induces Drp1-dependent fission)

For robust analysis, establish clear morphological categories beforehand and conduct blinded scoring. Time-lapse imaging at appropriate intervals (typically 5-10 seconds between frames) will capture the dynamic nature of fission events without photobleaching or phototoxicity.

What controls should be included when studying Ccdc51 in mitochondrial fission assays?

Rigorous experimental design requires these controls:

  • Positive controls: Include Drp1 knockdown/knockout as a positive control for severely impaired fission . Drp1 depletion nearly eliminates mitochondrial fission events and prevents stress-induced fragmentation .

  • Rescue experiments: When studying specific domains or mutations of Ccdc51, always include wild-type Ccdc51 rescue experiments to establish baseline functional recovery .

  • Domain-specific mutants: Compare mutations across different domains (e.g., transmembrane domains TM1 vs TM2, matrix coiled-coil vs. IMS coiled-coil) to isolate structure-function relationships .

  • Stress-response assays: Include both unstressed conditions and stress inducers (such as BAPTA-AM) to assess the impact of Ccdc51 on both steady-state dynamics and stress-responsive fission .

  • Multiple time points: For stress-induced fragmentation, assess multiple time points (e.g., 10 and 30 minutes post-treatment) to capture both the kinetics and extent of response .

Which structural domains of Ccdc51 are critical for its function in mitochondrial dynamics?

Ccdc51 contains several important structural domains that contribute differently to its function:

  • Transmembrane domains (TMs):

    • TM1 is critical for function, as mutations in this domain prevent rescue of mitochondrial morphology defects in Ccdc51-depleted cells

    • TM2 appears less crucial, as mutations in the polar amino acids in this region (TM2-NP) do not prevent functional rescue

    • TM1 mutants (NP and G4A) localize to mitochondria but abnormally concentrate in discrete foci, suggesting improper distribution

  • Coiled-coil domains:

    • The intermembrane space (IMS) coiled-coil domain is essential, as deletion prevents rescue of morphology defects and causes abnormal protein localization to discrete foci

    • The matrix coiled-coil domain is dispensable for promoting mitochondrial fission; its deletion actually enhances fragmentation beyond wild-type rescue levels

These domain-specific functions suggest Ccdc51 has distinct structural elements that contribute to proper localization versus active promotion of fission, enabling precise experimental targeting of specific activities.

How do mutations in Ccdc51 affect its interaction with other mitochondrial proteins?

The relationship between Ccdc51 mutations and protein interactions remains an active area of investigation, but current evidence suggests:

  • Wild-type Ccdc51 overexpression promotes spatial association with Drp1, the primary mechanoenzyme of mitochondrial fission . This association is likely functional, as it correlates with increased mitochondrial fragmentation.

  • Mutations in TM1 and the IMS coiled-coil domain cause abnormal localization of Ccdc51 to discrete foci , potentially altering interactions with binding partners or fission machinery.

  • Deletion of the matrix coiled-coil domain results in more uniform distribution along mitochondria and enhanced fragmentation , suggesting this domain may normally regulate or constrain interactions with fission-promoting factors.

For interaction studies, researchers should consider techniques such as proximity labeling (BioID, APEX) or co-immunoprecipitation combined with domain mutant analysis to map the interaction surfaces between Ccdc51 and potential binding partners.

What is the molecular mechanism by which Ccdc51 influences inner mitochondrial membrane dynamics?

While the precise molecular mechanism remains under investigation, current evidence suggests:

Ccdc51 appears to function as a spatiotemporal marker for a subset of mitochondrial fission events . Its role may involve coordinating inner membrane remodeling with outer membrane constriction during the fission process.

The requirement for specific domains (TM1 and IMS coiled-coil) suggests Ccdc51 may:

  • Influence membrane curvature at prospective fission sites

  • Recruit or activate other IMM-associated proteins

  • Facilitate communication between inner and outer membrane fission machinery

Importantly, mitochondrial morphology in Ccdc51-depleted cells shows both hyperfusion and distinctive lamellar structures , indicating it may play roles in both promoting fission and maintaining normal cristae architecture.

Is Ccdc51 implicated in retinal disorders or other diseases?

Emerging evidence suggests potential involvement of CCDC51 in retinal disorders:

A frameshift variant in CCDC51 (c.244_246delins17 p.W82Vfs*4) has been identified as a candidate gene defect for autosomal recessive rod-cone dystrophy (RCD) in a consanguineous family . This finding was supported by:

  • Whole exome sequencing identifying the homozygous frameshift variant in an 18 Mb homozygous region on chromosome 3

  • Co-segregation analyses in available family members

  • Expression studies confirming CCDC51 expression in relevant tissues

  • Immunolocalization studies with mitochondrial markers in fibroblasts and retinal sections

The patient presented with relatively mild RCD, suggesting CCDC51 dysfunction may lead to progressive retinal degeneration . This association is particularly interesting given mitochondria's critical role in high-energy tissues like the retina.

How might manipulating Ccdc51 function have therapeutic applications?

While direct therapeutic applications remain speculative, the fundamental role of Ccdc51 in mitochondrial dynamics suggests several potential areas for therapeutic development:

  • Retinal degeneration: Given the association with rod-cone dystrophy , modulating Ccdc51 function might represent a therapeutic strategy for certain inherited retinal disorders.

  • Mitochondrial dynamics disorders: Conditions characterized by imbalanced fusion/fission might benefit from targeted Ccdc51 modulation, as it influences fission rates without completely abolishing dynamics .

  • Mitochondrial stress response: Ccdc51 appears involved in stress-induced mitochondrial fragmentation , suggesting it might be targeted to enhance cellular resilience to specific stressors.

Developing therapeutic approaches would require precise understanding of structure-function relationships to design compounds that modulate specific aspects of Ccdc51 activity rather than simply eliminating or overexpressing the entire protein.

What disease models are appropriate for studying Ccdc51 dysfunction?

Based on current understanding, researchers might consider these disease models:

  • Retinal degeneration models:

    • Knock-in mouse models carrying the identified human frameshift variant

    • Patient-derived induced pluripotent stem cells differentiated into retinal cells

  • Mitochondrial dynamics disorder models:

    • Ccdc51 knockout or knockdown in high-energy demanding tissues (brain, muscle, retina)

    • Combined manipulation of Ccdc51 with other fission/fusion proteins to model pathological states

  • Stress response models:

    • Cellular models exposed to specific stressors that trigger mitochondrial fragmentation (e.g., calcium dysregulation using BAPTA-AM)

    • Models of excitotoxicity or oxidative stress where mitochondrial dynamics play protective roles

When developing these models, researchers should carefully consider the dosage and timing of Ccdc51 manipulation, as both complete loss and overexpression produce distinct phenotypes .

How does Ccdc51 coordinate with the outer mitochondrial membrane fission machinery?

The coordination between Ccdc51 (inner membrane) and outer membrane fission machinery represents a sophisticated research question:

To study this coordination:

  • Perform super-resolution microscopy to visualize the spatial relationship between Ccdc51 and OMM proteins like Drp1, Mff, and Mid49/51

  • Use live-cell imaging with dual-color labeling to determine the temporal sequence of Ccdc51 enrichment relative to Drp1 assembly

  • Investigate whether Ccdc51 influences the GTPase activity of Drp1 through in vitro reconstitution experiments

The key conceptual challenge is understanding how fission is coordinated across two distinct membrane bilayers, and Ccdc51 appears to be a critical piece of this puzzle.

How do different stress conditions affect Ccdc51-dependent mitochondrial dynamics?

Different cellular stressors engage mitochondrial fission machinery through diverse mechanisms:

BAPTA-AM (calcium chelator) induces rapid Drp1-dependent mitochondrial fragmentation that is delayed, but not prevented, in Ccdc51-depleted cells . This parallels observations in yeast where Δmdm33 cells were resistant to sodium azide–induced Dnm1-dependent fragmentation .

Future research should examine:

  • Whether oxidative stress, mitophagy induction, or apoptotic stimuli differentially engage Ccdc51-dependent pathways

  • If Ccdc51's role varies across stress types or intensities

  • Whether post-translational modifications of Ccdc51 occur during stress responses

Understanding stress-specific roles could reveal context-dependent functions and potentially identify conditions where Ccdc51 function becomes particularly critical.

How does Ccdc51 mutation or dysfunction affect mitochondrial bioenergetics and cellular metabolism?

While the current research focuses on morphological effects, the connection to bioenergetics merits investigation:

The inner mitochondrial membrane houses the electron transport chain complexes essential for oxidative phosphorylation. Given Ccdc51's localization to this membrane and role in morphology maintenance, it likely influences bioenergetic function through:

  • Effects on cristae organization, which impacts respiratory efficiency

  • Influence on mitochondrial quality control through promoting appropriate fission

  • Potential direct interactions with metabolic proteins or complexes

Researchers should employ techniques such as:

  • Seahorse extracellular flux analysis to measure oxygen consumption and glycolytic rates

  • Membrane potential assessments using potentiometric dyes

  • Metabolomic profiling to identify shifts in cellular metabolism

  • Blue native PAGE to examine respiratory supercomplex assembly

This research direction could reveal whether Ccdc51's primary function relates to membrane architecture maintenance or if it plays direct roles in mitochondrial metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.