Recombinant Mouse Coiled-coil domain-containing protein 56 (Ccdc56)

What is CCDC56 and what are its key structural characteristics?

CCDC56 (also known as COA3 or MITRAC12) is a small mitochondrial protein characterized by the presence of coiled-coil domains that facilitate protein-protein interactions. In humans, CCDC56 consists of 106 amino acids with the sequence: MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS . In Drosophila melanogaster, the protein is slightly smaller at 87 amino acids, yet shares 42% amino acid identity with the human ortholog . While mouse-specific data is limited in the provided search results, the high conservation across species suggests similar structural properties in mouse CCDC56.

Methodological approach for structural analysis:

• Sequence alignment tools to compare mouse CCDC56 with human and Drosophila orthologs

• Secondary structure prediction algorithms to identify coiled-coil domains

• Subcellular fractionation combined with Western blotting to confirm mitochondrial localization

• Immunofluorescence microscopy using specific antibodies for visualization in situ

Where is CCDC56 localized in cells and how can researchers confirm this localization?

CCDC56 primarily localizes to mitochondria, consistent with its function in mitochondrial respiratory chain assembly. Subcellular fractionation studies in Drosophila embryos have confirmed this localization, with anti-CCDC56 antibodies detecting the protein predominantly in the mitochondrial fraction rather than the post-mitochondrial supernatant . In human cell lines such as U-251 MG, immunofluorescent staining shows positive CCDC56 signals specifically in mitochondria .

Recommended protocol for localization studies:

• Perform subcellular fractionation using differential centrifugation (900 × g to remove nuclei, followed by 9000 × g to isolate mitochondria)

• Analyze fractions by Western blotting with anti-CCDC56 antibodies, using organelle markers such as porin (mitochondria) and GAPDH (cytosol) as controls

• Confirm localization using immunofluorescence microscopy with mitochondrial co-staining (e.g., MitoTracker)

• For higher resolution, consider immuno-electron microscopy to determine submitochondrial localization

What is the primary physiological function of CCDC56?

CCDC56 functions as a core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase) complex . This complex plays a crucial regulatory role in the assembly of cytochrome c oxidase (COX), which is the terminal enzyme of the mitochondrial electron transport chain. Specifically, CCDC56:

• Regulates the translation of mitochondrially-encoded cytochrome c oxidase subunit 1 (MT-CO1)

• Facilitates the assembly of nuclear-encoded components imported into mitochondria

• Coordinates the integration of both mitochondrial and nuclear-encoded subunits into the functional COX complex

Evidence for this function comes from knockout studies in Drosophila, where ccdc56 knockout flies exhibited developmental delay, lethality, and a dramatic decrease in COX levels and activity . This indicates that CCDC56 is essential for proper COX function and organism viability.

What are the optimal conditions for expressing and purifying recombinant CCDC56?

Based on established protocols for human CCDC56, the following approach is recommended for mouse CCDC56:

Expression system:

• E. coli-based expression using the PET28a vector system, which has been successfully used for human CCDC56

• Bacterial culture conditions: typically 37°C growth until OD600 reaches 0.6-0.8, followed by induction with IPTG (0.5-1 mM) and expression at 16-25°C for 4-16 hours

Purification strategy:

• Affinity chromatography using 6×His-tag, with binding to Ni-NTA resin

• Wash buffers containing low imidazole (10-30 mM) to reduce non-specific binding

• Elution with 300 mM imidazole

• Typical purity achieved is approximately 85%, as determined by SDS-PAGE with Coomassie Brilliant Blue staining

Final preparation and storage:

• Lyophilization from sterile PBS (58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4)

• Addition of protectants (5% trehalose and 5% mannitol) before lyophilization

• Reconstitution at 0.25 μg/μl in 200 μl sterile water for short-term storage

• For long-term storage, addition of an equal volume of glycerol and storage at -20°C to -80°C

How can researchers effectively design CCDC56 knock-out or knock-down experiments?

Designing effective genetic manipulation experiments for CCDC56 requires careful consideration of its essential nature and potential genomic context:

CRISPR/Cas9-based knockout approaches:

• Design guide RNAs targeting the coding sequence of mouse CCDC56

• Consider using conditional knockout systems (Cre-loxP) to control timing and tissue specificity, as complete knockout may be lethal based on Drosophila studies

• Verify knockout at both genomic (PCR and sequencing) and protein (Western blot) levels

• Include rescue experiments with wild-type CCDC56 to confirm phenotype specificity

RNA interference-based knockdown:

• Design siRNA or shRNA constructs specific to mouse CCDC56 mRNA

• Use inducible systems (e.g., Tet-On/Off) to control the degree and timing of knockdown

• Titrate knockdown levels to avoid complete loss of function if studying non-lethal phenotypes

• Validate knockdown efficiency by qRT-PCR and Western blot

Special considerations:

• In Drosophila, CCDC56 is encoded on a bicistronic transcript with mitochondrial transcription factor B1 (mtTFB1) ; verify whether a similar arrangement exists in mice to avoid unintended effects on neighboring genes

• Design functional assays focusing on cytochrome c oxidase activity, which is most directly affected by CCDC56 dysfunction

• Monitor mitochondrial morphology and membrane potential as secondary readouts

What methods are most effective for studying CCDC56 protein interactions?

Given CCDC56's small size (106 amino acids in humans, likely similar in mice) and mitochondrial localization, specialized approaches are recommended:

In vivo interaction studies:

• Proximity labeling techniques:

  • BioID or TurboID fusion to CCDC56 to biotinylate proximal proteins

  • APEX2 fusion for peroxidase-based proximity labeling

  • These methods are particularly valuable for identifying transient interactions in the native mitochondrial environment

• Co-immunoprecipitation approaches:

  • Use mild detergents (0.5-1% digitonin or 0.5% DDM) to maintain native protein complexes

  • Consider crosslinking before extraction to stabilize transient interactions

  • Validate with reciprocal co-IP experiments

Structural and biophysical methods:

• For direct interaction studies with purified components:

  • Surface plasmon resonance (SPR)

  • Microscale thermophoresis (MST)

  • Isothermal titration calorimetry (ITC)

• For complex assembly analysis:

  • Blue native PAGE followed by second-dimension SDS-PAGE

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

Validation strategies:

• Confirm interactions using multiple complementary techniques

• Generate interaction-deficient mutants to establish specificity

• Assess functional consequences of disrupting specific interactions

How does CCDC56 contribute to cytochrome c oxidase (COX) assembly and function?

CCDC56 plays a critical role in COX assembly through multiple mechanisms:

• Early-stage assembly regulation:

  • CCDC56 functions within the MITRAC complex as an assembly intermediate for COX

  • It specifically regulates the translation of mitochondrially-encoded COX subunit 1 (MT-CO1), the core catalytic subunit

  • Acts as a coordinator between mitochondrial translation and the import of nuclear-encoded subunits

• Functional impact of CCDC56 disruption:

  • Studies in Drosophila demonstrate that CCDC56 knockout results in dramatic reduction of COX levels and activity

  • This suggests CCDC56 is essential for the proper biogenesis of functional COX complexes

  • The defect appears specific to COX rather than affecting other respiratory chain complexes

• Proposed assembly mechanism:

  • CCDC56 likely binds to newly synthesized MT-CO1 to stabilize it

  • Facilitates the recruitment of early assembly factors and nuclear-encoded subunits

  • Potentially acts as a quality control checkpoint in COX assembly

Experimental approaches to study CCDC56's role in COX assembly:

What are the implications of CCDC56 dysfunction for mitochondrial disease research?

CCDC56 dysfunction has significant implications for understanding and modeling mitochondrial diseases:

• Disease relevance:

  • As a COX assembly factor, CCDC56 dysfunction would primarily manifest as COX deficiency

  • COX deficiencies are associated with a spectrum of mitochondrial disorders including Leigh syndrome, encephalomyopathies, and cardiomyopathies

  • The covariance test data suggests potential clinical relevance with a Tc value of 0.69, though with a non-significant p-value of 0.50

• Research applications:

  • Mouse models with CCDC56 manipulation could serve as valuable tools to study tissue-specific effects of COX deficiency

  • Partial knockdown models may mimic the variable penetrance seen in mitochondrial disorders

  • Such models could be used to test potential therapeutic interventions for mitochondrial COX deficiencies

• Experimental considerations:

  • Complete knockout may be lethal based on Drosophila studies , necessitating conditional approaches

  • Tissue-specific knockouts could reveal differential sensitivity of tissues to COX deficiency

  • Partial knockdown may produce more subtle phenotypes useful for therapeutic testing

• Phenotypic characterization:

  • Primary analysis should focus on tissues with high mitochondrial density (heart, brain, skeletal muscle)

  • Functional assessments should include exercise capacity, neurological function, and cardiac performance

  • Molecular analyses should examine COX assembly, mitochondrial ultrastructure, and compensatory responses

How does the potential bicistronic expression of CCDC56 affect experimental design?

In Drosophila, CCDC56 is encoded in the 5'-untranslated region of the mitochondrial transcription factor B1 (mtTFB1) transcript, forming a bicistronic mRNA . This unusual genomic arrangement has significant implications for experimental design:

• Genomic context analysis:

  • Researchers should first determine whether mouse CCDC56 shares this bicistronic arrangement

  • This can be accomplished through:

    • 5' RACE (Rapid Amplification of cDNA Ends) to characterize the full transcript

    • Northern blot analysis to identify transcript size and potential bicistronic nature

    • Analysis of available genomic and transcriptomic databases

• Genetic manipulation considerations:

  • If bicistronic expression exists in mice:

    • Gene knockout designs must avoid disrupting mtTFB1 expression

    • Promoter analysis should consider regulation of both genes

    • Rescue experiments should test both individual genes and the bicistronic construct

• Expression vector design:

  • For overexpression studies, consider creating:

    • CCDC56-only constructs

    • mtTFB1-only constructs (if relevant)

    • Complete bicistronic constructs

    • This approach was successfully employed in Drosophila studies

• Functional relationship investigation:

  • The bicistronic arrangement suggests potential co-regulation or functional coupling

  • Explore potential functional relationships between CCDC56 and mtTFB1 in:

    • Mitochondrial translation regulation

    • COX assembly

    • Mitochondrial gene expression coordination

What are the main challenges in detecting and quantifying CCDC56 in experimental samples?

Researchers may encounter several challenges when working with CCDC56:

• Small protein size limitations:

  • At approximately 11-12 kDa (based on human and Drosophila orthologs) , CCDC56 requires special considerations:

    • Use higher percentage (15-20%) SDS-PAGE gels or tricine-based systems

    • Consider specialized transfer conditions for Western blotting (lower voltage, longer time)

    • Be aware that standard size markers may not adequately cover this range

• Antibody-related challenges:

  • Limited commercial antibody availability for mouse CCDC56

  • Cross-reactivity concerns due to high conservation across species

  • Solution approaches:

    • Generate custom antibodies against species-specific epitopes

    • Use epitope-tagged versions for detection when possible

    • Validate antibody specificity using knockout/knockdown samples

• Extraction and solubilization:

  • As a mitochondrial protein, proper extraction requires:

    • Efficient mitochondrial isolation

    • Appropriate detergents for solubilization (digitonin or DDM recommended)

    • Prevention of protein degradation during sample preparation

• Quantification methods:

  • For absolute quantification:

    • Use recombinant standards of known concentration

    • Employ selected reaction monitoring (SRM) mass spectrometry with isotope-labeled peptide standards

  • For relative quantification:

    • Include appropriate loading controls for mitochondrial content

    • Consider normalization to multiple reference proteins

How can researchers distinguish between direct and indirect effects of CCDC56 manipulation?

When studying CCDC56 function through genetic manipulation, distinguishing direct from indirect effects presents a significant challenge:

• Rescue experiments:

  • The gold standard approach involves:

    • Re-expression of wild-type CCDC56 in knockout/knockdown models

    • Creation of structure-function mutants to map specific activities

    • Timing-controlled rescue (e.g., using inducible systems) to determine reversibility of phenotypes

• Temporal analysis:

  • Track the sequence of events following CCDC56 depletion:

    • Early changes (hours to days) are more likely to represent direct effects

    • Later changes may represent compensatory responses or downstream consequences

    • Use time-course experiments with multiple readouts

• Biochemical approaches:

  • For protein interaction studies:

    • Distinguish between stable complex components and transient interactors

    • Use crosslinking with different spacer lengths to identify proximity relationships

    • Complement with in vitro binding assays using purified components

• Systems biology integration:

  • Combine multiple data types:

    • Transcriptomics to identify expression changes

    • Proteomics to detect protein abundance and post-translational modifications

    • Metabolomics to assess functional consequences

    • Network analysis to distinguish primary perturbations from downstream effects

What emerging techniques could advance CCDC56 research?

Several cutting-edge approaches show promise for deepening our understanding of CCDC56 function:

• Cryo-electron microscopy:

  • Determination of CCDC56 structure within the MITRAC complex

  • Visualization of assembly intermediates at different stages of COX biogenesis

  • Structural basis for interactions with both mitochondrial and nuclear-encoded partners

• Single-cell approaches:

  • Analysis of cell-to-cell variability in CCDC56 expression and COX assembly

  • Correlation with mitochondrial heterogeneity and cellular fitness

  • Integration with spatial transcriptomics for tissue context

• Organoid and stem cell models:

  • Development of tissue-specific models of CCDC56 dysfunction

  • Analysis of developmental impacts in cerebral, cardiac, or muscle organoids

  • Patient-derived stem cell models of COX deficiency for therapeutic testing

• In vivo imaging:

  • Generation of fluorescent protein fusions or knock-in reporters for CCDC56

  • Live imaging of mitochondrial translation and assembly processes

  • Correlation with mitochondrial dynamics and turnover

How might CCDC56 research inform therapeutic approaches for mitochondrial disorders?

Understanding CCDC56 function has several potential therapeutic implications:

• Gene therapy approaches:

  • CCDC56 represents a compact therapeutic target (coding sequence ~300 bp)

  • Suitable for AAV-mediated delivery to affected tissues

  • Could potentially rescue COX deficiency in selected mitochondrial disorders

• Small molecule modulators:

  • Identification of compounds that can:

    • Stabilize partially assembled COX intermediates

    • Enhance CCDC56 function or compensate for its deficiency

    • Upregulate complementary assembly factors

• Metabolic bypasses:

  • Development of alternative electron transport pathways

  • Metabolic manipulations to reduce electron flux through the affected complex

  • Nutritional approaches to support ATP production via glycolysis

• Mitochondrial replacement:

  • For severe CCDC56-related disorders, mitochondrial replacement therapy could be considered

  • This approach would be particularly relevant if pathogenic variants in CCDC56 are identified in the human population