Recombinant Mouse Leucine-rich single-pass membrane protein 1 (Lsmem1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
Lsmem1; Gm889; Leucine-rich single-pass membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lsmem1
Target Protein Sequence
MTHSSQDAGSHGIQEEGRLYVVDSINDLNKLSLCPMESQHLFSLEDKIPNAGTAPGNGRR GLFFVGLLLVLTVSLALVFFAIFLIIQTGNQMEDVSRRLTAEGKDIDDLKKINNMIVKRL NQLDSEQN
Uniprot No.

Target Background

Database Links

KEGG: mmu:380755

UniGene: Mm.390463

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and basic characteristics of mouse Lsmem1?

Mouse Leucine-rich single-pass membrane protein 1 (Lsmem1) is a protein-coding gene that produces a single-pass transmembrane protein characterized by leucine-rich repeats. According to genomic data, Lsmem1 in Mus caroli (Ryukyu mouse) has an open reading frame (ORF) of 387 base pairs . The protein exists in multiple isoforms, with at least three confirmed variants (X1, X2, and X3) that likely exhibit differential expression patterns across tissues . The leucine-rich repeats in the extracellular domain are typically involved in protein-protein interactions and ligand binding, suggesting potential roles in cellular signaling or adhesion. The transmembrane domain anchors the protein to the cell membrane with a single membrane-spanning region, while the cytoplasmic domain likely interacts with intracellular signaling molecules.

Current annotation in genomic databases identifies this protein with the Entrez Gene ID 110307462, and several transcript variants have been documented, including XM_021179696.2, XM_029484342.1, XM_029484343.1, and XM_029484344.1 . These transcript variants correspond to different protein isoforms, which may have specialized functions in different cellular contexts or developmental stages.

What are the known functions of Lsmem1 in mouse models?

While the specific functions of Lsmem1 are still being elucidated, its structural characteristics provide important clues. As a leucine-rich single-pass membrane protein, Lsmem1 likely participates in protein-protein interactions, potentially functioning in signal transduction pathways or cell-cell recognition processes. The leucine-rich repeat (LRR) motifs typically serve as interaction interfaces for binding partners, suggesting roles in immune function, neural development, or tissue homeostasis.

Research methodologies to investigate Lsmem1 function typically include:

  • Gene knockout or knockdown studies to observe phenotypic changes

  • Protein interaction studies using co-immunoprecipitation or yeast two-hybrid systems

  • Expression analysis across tissues and developmental stages using RT-PCR or RNA-Seq

  • Subcellular localization studies using fluorescently tagged Lsmem1 constructs

To properly characterize Lsmem1 function, it is recommended to utilize recombinant expression systems that maintain proper post-translational modifications, as these may be crucial for protein function. While prokaryotic systems provide high yield, mammalian expression systems may better preserve the native conformation and modification state of Lsmem1.

What expression patterns does Lsmem1 exhibit across mouse tissues and developmental stages?

Expression analysis of Lsmem1 requires careful consideration of tissue specificity and developmental timing. Current data suggests variable expression across tissues, with potential regulation during specific developmental windows. To effectively map Lsmem1 expression patterns, researchers should consider:

  • Quantitative RT-PCR analysis across a panel of tissues and developmental timepoints

  • In situ hybridization to visualize spatial expression patterns

  • Western blot analysis with isoform-specific antibodies

  • Single-cell RNA sequencing to identify cell type-specific expression

For comprehensive expression profiling, researchers should examine both mRNA and protein levels, as post-transcriptional regulation may result in discrepancies between transcript abundance and protein expression. When designing primers for expression analysis, consider the different isoforms (X1, X2, X3) to accurately capture the complete expression profile .

What are the optimal conditions for expression and purification of recombinant mouse Lsmem1?

Optimizing the expression and purification of recombinant mouse Lsmem1 requires careful consideration of expression systems, culture conditions, and purification protocols. Based on similar studies with membrane proteins and other mouse recombinant proteins, the following methodological approach is recommended:

Expression System Selection:
While the search results don't provide Lsmem1-specific protocols, the methodology for mouse plac1 expression can be adapted as a starting point. For membrane proteins like Lsmem1, consider testing multiple expression systems:

  • Prokaryotic System: BL21(DE3) E. coli strain has shown success for other mouse proteins when cultured in TB medium with 0.25 mM IPTG induction at 15°C for 24 hours . Lower temperatures often improve proper folding of membrane proteins.

  • Eukaryotic Systems: For proper post-translational modifications, mammalian systems (HEK293, CHO) or insect cell systems (Sf9, Hi5) may be more appropriate for transmembrane proteins.

Optimization Parameters Table:

ParameterRecommended Range for TestingNotes
Expression HostBL21(DE3), Rosetta, HEK293, CHO, Sf9Select based on required post-translational modifications
Culture MediumTB, LB, 2YT for prokaryotic; DMEM, F12 for eukaryoticTB medium showed superior results for mouse plac1
Induction Temperature15°C, 25°C, 37°CLower temperatures (15°C) often improve folding
Inducer Concentration0.1-1.0 mM IPTG for prokaryotic0.25 mM IPTG was optimal for mouse plac1
Induction Duration4-48 hours24 hours showed good expression for similar proteins

Purification Strategy:
For membrane proteins like Lsmem1, solubilization is a critical step. Based on similar protocols:

  • Cell lysis using sonication or homogenization

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization with detergents (2% sarkosyl has shown good results for other proteins)

  • Purification using affinity chromatography (His-tag or fusion tags)

  • Further purification by size exclusion or ion exchange chromatography

Protein purity should be assessed by SDS-PAGE and Western blotting, with functional validation through appropriate binding or activity assays.

How can I overcome challenges in expressing the full-length transmembrane domain of Lsmem1?

Expressing full-length membrane proteins like Lsmem1 with intact transmembrane domains presents significant challenges. These challenges include proper membrane insertion, protein aggregation, and maintaining native conformation. A methodological approach to address these issues includes:

1. Expression Construct Design:

  • Include the complete coding sequence with the transmembrane domain

  • Consider using fusion tags that enhance solubility (SUMO, MBP, Thioredoxin)

  • Position affinity tags (His, FLAG) away from the transmembrane domain

  • Include a removable tag system using precision protease sites

2. Host Cell Selection:

  • E. coli C41(DE3) or C43(DE3) strains engineered for membrane protein expression

  • Eukaryotic systems for proper membrane insertion and post-translational modifications

  • Consider cell-free expression systems with supplied membrane mimetics

3. Solubilization and Stabilization Strategies:

  • Test multiple detergent classes (ionic, non-ionic, zwitterionic)

  • Screen detergent concentrations above their critical micelle concentration

  • Consider using lipid nanodiscs or amphipols for native-like membrane environments

  • Add stabilizing agents like glycerol or specific lipids during purification

4. Validation Methods:

  • Circular dichroism to assess secondary structure

  • Size-exclusion chromatography to evaluate monodispersity

  • Functional assays to confirm biological activity

  • Cryo-EM or X-ray crystallography for structural validation

When working with the transmembrane domain of Lsmem1, it's crucial to monitor protein quality at each step of expression and purification. The inclusion of appropriate controls, such as known membrane proteins with similar characteristics, can help benchmark your optimization process.

What strategies can be employed to study protein-protein interactions involving Lsmem1?

Investigating protein-protein interactions (PPIs) of Lsmem1 requires specialized approaches that account for its membrane localization. Since Lsmem1 contains leucine-rich repeats, which are known interaction domains, identifying binding partners is crucial for understanding its function. Based on research methodologies used for similar membrane proteins, the following approaches are recommended:

1. Proximity-Based Labeling Methods:

  • BioID or TurboID fusion with Lsmem1 to identify proteins in close proximity in living cells

  • APEX2 fusion for electron microscopy-compatible proximity labeling

  • Protocol involves expressing the fusion protein, adding biotin, cell lysis, and affinity purification of biotinylated proteins followed by mass spectrometry

2. Co-Immunoprecipitation Strategies:

  • Gentle solubilization with appropriate detergents to maintain interaction integrity

  • Antibody-based pulldown of Lsmem1 and associated proteins

  • Crosslinking prior to lysis to stabilize transient interactions

  • Mass spectrometry identification of co-precipitated proteins

3. Membrane-Based Yeast Two-Hybrid:

  • Split-ubiquitin membrane yeast two-hybrid system specifically designed for membrane proteins

  • MYTH (Membrane Yeast Two-Hybrid) system where interaction reconstitutes a transcription factor

  • Library screening approach to identify novel interactors

4. Surface Plasmon Resonance (SPR) Analysis:

  • Immobilization of purified Lsmem1 on sensor chips with appropriate detergent conditions

  • Real-time measurement of binding kinetics with potential partners

  • Determination of affinity constants for validated interactions

5. Computational Prediction and Validation:

  • Structural modeling of Lsmem1 leucine-rich repeats

  • Docking simulations with candidate interactors

  • Experimental validation of top predictions using targeted approaches

When studying Lsmem1 interactions, it's essential to include appropriate controls, such as mutated versions of Lsmem1 with disrupted leucine-rich repeats, to confirm the specificity of identified interactions.

What are the most effective transfection methods for introducing Lsmem1 constructs into mammalian cells?

Efficient transfection of Lsmem1 constructs into mammalian cells requires optimization of several parameters to ensure high expression while maintaining cell viability. Based on methodologies used for similar membrane proteins, the following approaches are recommended:

Chemical Transfection Methods:

  • Lipid-based transfection: Lipofectamine 3000 or FuGENE HD typically provide good results for membrane proteins with optimization of DNA:lipid ratios (1:2 to 1:4)

  • Calcium phosphate precipitation: Cost-effective but requires optimization for each cell type

  • PEI (Polyethylenimine): Excellent for large-scale transfections with optimization of nitrogen/phosphate (N/P) ratio

Physical Transfection Methods:

  • Electroporation: Effective for difficult-to-transfect cell types with optimization of voltage and pulse duration

  • Nucleofection: Combines electroporation with cell-specific solutions for enhanced efficiency

  • Microinjection: For single-cell studies requiring precise control

Viral Transduction Methods:

  • Lentiviral vectors: Ideal for stable integration and expression, especially in primary cells

  • Adenoviral systems: For high-level transient expression without genomic integration

  • Baculovirus-mammalian cell (BacMam) system: Effective for large membrane proteins

Optimization Parameters Table:

ParameterOptimization RangeNotes
DNA Concentration0.5-2 μg per well (6-well plate)Higher concentrations may increase toxicity
Cell Confluency70-90%Actively dividing cells transfect more efficiently
Incubation Time4-72 hoursMembrane proteins may require longer expression times
Serum ConditionsWith/without serum during transfectionSome reagents require serum-free conditions
EnhancersPLUS reagent, sodium butyrateCan improve expression of difficult constructs

Transfection Protocol Optimization:

  • Seed cells to reach 70-80% confluency at transfection

  • Prepare plasmid DNA in serum-free medium

  • Prepare transfection reagent separately and incubate per manufacturer's protocol

  • Mix DNA with transfection reagent and incubate

  • Add complexes dropwise to cells

  • Analyze expression after 24-72 hours using immunofluorescence, flow cytometry, or Western blotting

For Lsmem1 specifically, consider using a fluorescent tag (GFP, mCherry) to monitor localization and expression levels, but ensure the tag doesn't interfere with the transmembrane domain function.

How can I design effective CRISPR/Cas9 strategies for Lsmem1 gene editing in mouse models?

Designing effective CRISPR/Cas9 strategies for Lsmem1 gene editing requires careful consideration of target specificity, efficiency, and functional validation. The following methodological approach is recommended:

1. gRNA Design and Selection:

  • Target early exons to maximize disruption of protein function

  • Avoid regions with known SNPs or structural variations

  • Prioritize gRNAs with high on-target and low off-target scores

  • Design multiple gRNAs (3-4) targeting different regions of Lsmem1

  • Use algorithms such as CHOPCHOP, CRISPOR, or Benchling for gRNA design

Recommended Target Sequence Criteria:

  • GC content between 40-60%

  • Minimal self-complementarity to prevent secondary structure formation

  • Strong PAM sequence (NGG for SpCas9)

  • Targeting conserved functional domains, such as the leucine-rich repeats

2. Delivery Method Selection:

  • Ex vivo approach: For manipulation of mouse embryonic stem cells followed by blastocyst injection

  • In vivo approach: Direct delivery to target tissues using AAV or lentiviral vectors

  • Zygote injection: For germline editing to create heritable modifications

3. Validation of Editing Efficiency:

  • T7 Endonuclease I assay: Quick assessment of indel formation

  • Sanger sequencing: For detailed characterization of editing events

  • Next-generation sequencing: For comprehensive analysis of editing outcomes and off-target effects

  • Western blotting: To confirm protein depletion

  • qRT-PCR: To evaluate transcript levels

4. Phenotypic Analysis:

  • Tissue-specific expression analysis: Compare Lsmem1 expression in wildtype vs. edited mice

  • Histological examination: Assess morphological changes in tissues expressing Lsmem1

  • Functional assays: Develop specific assays based on predicted Lsmem1 function

  • Behavioral analysis: If Lsmem1 is expressed in neural tissues

5. Off-Target Analysis:

  • In silico prediction of potential off-target sites

  • Targeted sequencing of top predicted off-target sites

  • Whole-genome sequencing for comprehensive off-target detection

  • GUIDE-seq or DISCOVER-seq for unbiased genome-wide off-target identification

When designing CRISPR strategies for Lsmem1, consider the existence of multiple isoforms (X1, X2, X3) and target regions common to all variants to ensure complete knockout, or design isoform-specific strategies for selective targeting.

What immunological techniques are most appropriate for detecting and quantifying Lsmem1 expression in tissue samples?

Detecting and quantifying Lsmem1 expression in tissue samples requires a combination of immunological techniques that address both sensitivity and specificity challenges. The following methodological approaches are recommended:

1. Immunohistochemistry (IHC) and Immunofluorescence (IF):

2. Western Blotting:

  • Sample preparation: Optimize lysis buffers containing appropriate detergents for membrane protein extraction (RIPA buffer with 1% NP-40 or Triton X-100)

  • Separation considerations: Use 10-12% SDS-PAGE gels for optimal resolution

  • Transfer optimization: Extended transfer times or specialized conditions for membrane proteins

  • Blocking strategy: 5% non-fat milk or BSA in TBST

  • Detection method: Enhanced chemiluminescence (ECL) or fluorescent secondary antibodies for quantification

  • Data analysis: Normalization to housekeeping proteins (β-actin, GAPDH) for relative quantification

3. Flow Cytometry:

  • Sample preparation: Single-cell suspensions from tissues with gentle dissociation methods

  • Permeabilization: For detecting both surface and intracellular domains of Lsmem1

  • Antibody titration: Determine optimal concentrations to maximize signal-to-noise ratio

  • Multiparameter approach: Combine with lineage markers for cell-type specific expression

  • Controls: Fluorescence minus one (FMO), isotype controls, and blocking peptides

4. Enzyme-Linked Immunosorbent Assay (ELISA):

  • Sample preparation: Standardized protein extraction protocols

  • Assay format: Sandwich ELISA using capture and detection antibodies

  • Standard curve: Recombinant Lsmem1 protein for absolute quantification

  • Sensitivity enhancement: Amplification systems for low abundance detection

5. Mass Spectrometry-Based Approaches:

  • Targeted proteomics: Selected/Multiple Reaction Monitoring (SRM/MRM) for specific peptide quantification

  • Sample enrichment: Immunoprecipitation prior to MS analysis

  • Internal standards: Isotope-labeled peptides for absolute quantification

For all immunological techniques, antibody validation is critical. Consider using genetic controls (Lsmem1 knockout tissues) or peptide competition assays to confirm antibody specificity. When working with multiple isoforms of Lsmem1 , select antibodies that either recognize common epitopes or are isoform-specific, depending on your research question.

How should I analyze differential expression of Lsmem1 in disease models compared to wild-type mice?

Analyzing differential expression of Lsmem1 between disease models and wild-type mice requires a robust methodological approach that accounts for biological variability and technical factors. The following comprehensive strategy is recommended:

1. Experimental Design Considerations:

  • Include sufficient biological replicates (minimum n=5 per group)

  • Account for confounding variables (age, sex, genetic background)

  • Consider time course analyses for dynamic expression changes

  • Include appropriate controls for each disease model

2. Transcriptomic Analysis Methods:

  • RT-qPCR:

    • Design primers specific to conserved regions across Lsmem1 isoforms

    • Use multiple reference genes validated for stability in your experimental system

    • Apply relative quantification using the 2^(-ΔΔCt) method with statistical validation

  • RNA-Sequencing:

    • Minimum sequencing depth of 30M reads per sample for reliable detection

    • Apply appropriate normalization methods (TPM, FPKM, or DESeq2 normalization)

    • Account for batch effects using ComBat or similar approaches

    • Analyze isoform-specific expression patterns (X1, X2, X3)

3. Protein-Level Analysis:

  • Western blotting with densitometry for semi-quantitative analysis

  • Targeted proteomics using LC-MS/MS for absolute quantification

  • Spatial analysis using IHC with digital image quantification

4. Statistical Analysis Framework:

  • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • Apply appropriate statistical tests (t-test, ANOVA, or non-parametric alternatives)

  • Control for multiple testing (Benjamini-Hochberg correction)

  • Calculate effect sizes (Cohen's d) in addition to p-values

5. Data Interpretation Guidelines:

  • Correlate Lsmem1 expression changes with disease progression

  • Examine relationship with known disease biomarkers

  • Consider tissue-specific or cell-type specific changes

  • Integrate with pathway analysis to establish functional context

6. Validation Strategies:

  • Confirm key findings using independent cohorts

  • Validate with complementary techniques (if discovered by RNA-seq, validate with qPCR)

  • Consider in vitro models to establish causality

When analyzing Lsmem1 expression, pay particular attention to its potential regulation by inflammatory factors, as leucine-rich repeat proteins often function in immune responses. Additionally, correlate expression patterns with relevant disease markers to establish potential functional relationships.

What bioinformatic approaches are recommended for predicting functional domains and potential interaction partners of Lsmem1?

Computational prediction of Lsmem1 functional domains and interaction partners requires integrative bioinformatic approaches that leverage structural, evolutionary, and functional data. The following methodological framework provides a comprehensive strategy:

1. Sequence-Based Domain Prediction:

  • Motif identification: InterProScan, SMART, Pfam for leucine-rich repeat (LRR) pattern recognition

  • Transmembrane domain prediction: TMHMM, Phobius, HMMTOP for membrane topology mapping

  • Signal peptide prediction: SignalP, Phobius for identifying secretory pathway targeting

  • Secondary structure prediction: PSIPRED, JPred for structural element identification

  • Disordered region prediction: IUPred2A, PONDR for flexible regions that may mediate interactions

2. Structural Modeling and Analysis:

  • Homology modeling: SWISS-MODEL, I-TASSER, or AlphaFold2 using known LRR-containing proteins as templates

  • Model validation: PROCHECK, VERIFY3D for quality assessment

  • Molecular dynamics simulations: GROMACS or AMBER to predict conformational flexibility in a membrane environment

  • Binding site prediction: FTSite, CASTp for identifying potential interaction surfaces

3. Evolutionary Analysis for Functional Inference:

  • Ortholog identification: OrthoFinder, OrthoDB across species

  • Evolutionary conservation mapping: ConSurf for identifying functionally important residues

  • Coevolution analysis: GREMLIN, EVcouplings to identify co-evolving residues that may indicate interaction sites

  • Phylogenetic profiling: For identifying proteins with similar evolutionary patterns

4. Protein-Protein Interaction Prediction:

  • Interaction database mining: STRING, BioGRID, IntAct for known interactions of orthologs

  • Domain-based interaction prediction: DOMINE, 3did for domain-domain interaction likelihood

  • Machine learning approaches: PRINCE, SPRINT for integration of multiple features

  • Molecular docking: HADDOCK, ZDOCK for specific candidate partner evaluation

5. Functional Annotation Enrichment:

  • Gene Ontology analysis: Of predicted interaction partners using DAVID, g:Profiler

  • Pathway enrichment: KEGG, Reactome analysis of predicted interactome

  • Disease association: DisGeNET, OMIM for linking to potential pathological roles

6. Integration with Experimental Data:

  • Incorporate proteomics data when available

  • Validate top predictions using targeted experiments (co-IP, proximity labeling)

  • Iteratively refine predictions based on experimental feedback

When applying these approaches to Lsmem1, pay particular attention to the leucine-rich repeat domains, as these are likely to mediate specific protein-protein interactions. The single-pass transmembrane architecture suggests distinct functions for the extracellular and cytoplasmic domains, which should be modeled and analyzed separately.

How can I integrate transcriptomic and proteomic data to understand Lsmem1 function in different physiological contexts?

Integrating transcriptomic and proteomic data provides a comprehensive view of Lsmem1 biology across different physiological contexts. This multi-omics approach reveals regulatory mechanisms and functional relationships that might be missed by single-omics analysis. The following methodological framework outlines a systematic approach:

1. Data Collection and Preprocessing:

  • Transcriptomic data: Generate RNA-seq data with sufficient depth (>30M reads)

  • Proteomic data: Use both discovery proteomics (DDA) and targeted approaches (PRM/MRM)

  • Experimental design: Ensure matched samples for direct comparison

  • Quality control: Apply rigorous QC metrics for both data types

  • Normalization: Select appropriate methods for each data type (e.g., TMM for RNA-seq, global median for proteomics)

2. Initial Separate Analysis:

  • Identify differentially expressed transcripts of Lsmem1 isoforms

  • Quantify Lsmem1 protein abundance and post-translational modifications

  • Determine cellular localization through fractionation proteomics

  • Analyze temporal dynamics in each dataset independently

3. Multi-omics Integration Strategies:

  • Correlation analysis: Pearson/Spearman correlation between transcript and protein levels

  • Multivariate integration: Canonical correlation analysis (CCA) or partial least squares (PLS)

  • Network approaches: Weighted gene correlation network analysis (WGCNA) with both data types

  • Causal modeling: Bayesian networks to infer regulatory relationships

  • Visualization techniques: Multi-omics factor analysis (MOFA) for dimensionality reduction

4. Functional Context Analysis:

  • Pathway enrichment: Identify pathways where Lsmem1 shows coordinated changes at transcript and protein levels

  • Protein complex analysis: Examine co-expression patterns with known complex members

  • Regulatory element analysis: Correlate expression patterns with transcription factors and miRNAs

  • Cell-type deconvolution: Determine cell-specific expression patterns using reference signatures

5. Validation and Perturbation Studies:

  • Confirm key findings using orthogonal techniques

  • Perform perturbation experiments (knockdown/overexpression) to validate predicted relationships

  • Use CRISPR screens to identify functional genetic interactions

Integration Analysis Workflow:

StepTranscriptomic AnalysisProteomic AnalysisIntegration Approach
1RNA extraction & QCProtein extraction & QCSample matching
2Library preparation & sequencingLC-MS/MS analysisPlatform-specific processing
3Read alignment & quantificationPeptide/protein identificationData normalization
4Differential expression analysisDifferential abundance analysisCorrelation analysis
5Isoform analysisPTM profilingMulti-omics factor analysis
6Co-expression networkProtein interaction networkNetwork integration
7Pathway enrichmentFunctional annotationIntegrated pathway analysis

When integrating data for Lsmem1 specifically, examine discordance between transcript and protein levels as this may indicate post-transcriptional regulation. Additionally, leverage the isoform-specific information from transcriptomics to understand potential specialized functions of different Lsmem1 variants that may not be distinguishable at the protein level.

What roles might Lsmem1 play in immune response regulation based on its structural similarities to other leucine-rich repeat proteins?

Leucine-rich repeat (LRR) proteins are well-established mediators of immune function, suggesting potential immunoregulatory roles for Lsmem1. Based on structural homology and known functions of similar proteins, Lsmem1 may participate in several immune processes:

1. Pattern Recognition and Pathogen Sensing:
LRR domains are characteristic features of pattern recognition receptors (PRRs) such as Toll-like receptors (TLRs) and NOD-like receptors (NLRs), which recognize pathogen-associated molecular patterns (PAMPs). Lsmem1 may function similarly in:

  • Bacterial component recognition through its extracellular LRR domain

  • Viral nucleic acid detection pathways

  • Damage-associated molecular pattern (DAMP) sensing

This hypothesis is supported by the structural organization of Lsmem1 as a single-pass membrane protein with extracellular LRR domains , similar to TLRs. Experimental approaches to investigate this function include:

  • Ligand binding assays with purified Lsmem1 and pathogen components

  • Reporter assays measuring NF-κB activation upon Lsmem1 stimulation

  • Knockout studies examining susceptibility to infection

2. Adaptive Immune Regulation:
Many LRR-containing proteins participate in T-cell receptor (TCR) signaling and antigen presentation processes. Based on research with similar proteins, Lsmem1 could potentially:

  • Modulate T-cell activation thresholds

  • Influence antigen-presenting cell function

  • Participate in immune synapse formation

The research on LSD1 inhibition enhancing antigen presentation capabilities in mesenchymal stromal cells provides an interesting parallel, as epigenetic regulation may influence Lsmem1 expression in immune contexts. Methodological approaches to investigate this function include:

  • T-cell activation assays with Lsmem1-deficient antigen-presenting cells

  • Flow cytometry analysis of immune synapse components

  • In vivo immune response studies in Lsmem1 knockout models

3. Cytokine Signaling and Inflammatory Regulation:
LRR proteins often mediate cytokine receptor complexes and downstream signaling. Lsmem1 might function in:

  • IL-1 receptor family signaling

  • Type I interferon response pathways

  • Anti-inflammatory feedback mechanisms

To investigate these potential roles, researchers could employ:

  • Cytokine stimulation assays measuring STAT phosphorylation

  • Gene expression profiling after inflammatory challenges

  • Protein interaction studies with cytokine receptor components

4. Tissue-Specific Immune Homeostasis:
Different isoforms of Lsmem1 (X1, X2, X3) may have specialized functions in tissue-specific immune regulation, similar to tissue-specific roles observed for other LRR proteins. These might include:

  • Epithelial barrier function regulation

  • Neural-immune interaction mediation

  • Tissue-resident immune cell maintenance

Experimental approaches should include tissue-specific conditional knockout models and organoid systems to evaluate these potential functions.

The single transmembrane domain of Lsmem1 positions it as a potential signaling molecule that could transduce extracellular immune signals to intracellular responses, making it an interesting target for immunomodulatory therapeutic development.

How can mouse models with Lsmem1 modifications be used to investigate potential roles in cancer and autoimmune diseases?

Mouse models with Lsmem1 modifications provide powerful tools for investigating its potential roles in cancer and autoimmune diseases. The following methodological approaches outline how to develop and utilize these models effectively:

1. Generation of Lsmem1 Modified Mouse Models:

Constitutive Knockout Models:

  • CRISPR/Cas9-mediated deletion of Lsmem1 gene

  • Assessment of developmental consequences and baseline phenotype

  • Careful monitoring for spontaneous disease development

Conditional/Inducible Models:

  • Cre-loxP system targeting Lsmem1 with tissue-specific promoters

  • Temporal control using tamoxifen-inducible systems

  • Cell-type specific deletion (e.g., immune cells, epithelial cells)

Knock-in Models:

  • Reporter knock-ins (GFP, luciferase) to track expression

  • Introduction of point mutations identified in human disease

  • Humanized Lsmem1 models for therapeutic testing

2. Cancer Research Applications:

Tumor Initiation and Progression:

  • Cross Lsmem1 modified mice with established cancer models (e.g., MMTV-PyMT for breast cancer)

  • Chemical carcinogenesis protocols (e.g., AOM/DSS for colorectal cancer)

  • Monitor for changes in tumor incidence, growth rate, and metastatic potential

Tumor Microenvironment:

  • Analyze immune infiltration in tumors from Lsmem1-modified mice

  • Assess cytokine profiles and inflammatory signatures

  • Examine angiogenesis and stromal remodeling

Therapeutic Response:

  • Test standard chemotherapies and targeted agents

  • Evaluate immunotherapy efficacy (checkpoint inhibitors, CAR-T)

  • Develop Lsmem1-targeted therapeutics if applicable

3. Autoimmune Disease Applications:

Disease Susceptibility Models:

  • Challenge with established autoimmune induction protocols:

    • Experimental autoimmune encephalomyelitis (EAE) for multiple sclerosis

    • Collagen-induced arthritis (CIA) for rheumatoid arthritis

    • Imiquimod for psoriasis-like inflammation

  • Assess disease onset, severity, and progression

Mechanistic Studies:

  • Analyze T-cell activation, differentiation, and function

  • Examine B-cell responses and autoantibody production

  • Evaluate tissue-specific inflammatory responses

Therapeutic Intervention:

  • Test standard immunosuppressive treatments

  • Evaluate novel immunomodulatory approaches

  • Consider Lsmem1-targeted biologics if appropriate

4. Experimental Design Considerations:

Controls and Cohort Size:

  • Include appropriate littermate controls

  • Power analysis for determining sample size (typically n=10-15 per group)

  • Account for sex differences in immune responses

Phenotyping Depth:

  • Comprehensive immune profiling (flow cytometry, CyTOF)

  • Histopathological analysis of affected tissues

  • Molecular profiling (RNA-seq, proteomics)

  • Functional assays relevant to disease context

Data Integration:

  • Correlate phenotypic findings with molecular mechanisms

  • Validate key findings in human samples when possible

  • Develop translational pathways for promising insights

The leucine-rich repeat structure of Lsmem1 suggests potential roles in immune regulation, making it a particularly interesting target for autoimmune disease research. Similarly, the membrane localization positions it as a potential signaling molecule that could influence cancer cell behavior or tumor-immune interactions.

What are the emerging research directions and unanswered questions about Lsmem1 function and regulation?

Despite the growing body of knowledge, significant gaps remain in our understanding of Lsmem1 biology. Future research should address several key areas to fully elucidate the function and regulation of this leucine-rich single-pass membrane protein.

Fundamental Biology Questions:

  • What are the natural ligands or binding partners of Lsmem1?

  • How does the protein's membrane topology influence its function?

  • What is the three-dimensional structure of the leucine-rich repeat domain?

  • How is Lsmem1 expression regulated at transcriptional and post-transcriptional levels?

  • What are the functional differences between the multiple isoforms (X1, X2, X3) ?

The structural characterization of Lsmem1 requires advanced methodologies including cryo-electron microscopy or X-ray crystallography, potentially facilitated by membrane protein-specific crystallization techniques. Binding partner identification would benefit from proximity labeling approaches combined with mass spectrometry.

Cellular Function Investigations:

  • What intracellular signaling pathways are modulated by Lsmem1?

  • How does Lsmem1 trafficking and localization influence its function?

  • Does Lsmem1 form homo- or hetero-oligomeric complexes?

  • What role does Lsmem1 play in cell-cell communication?

Live-cell imaging with fluorescently tagged Lsmem1 constructs would help address trafficking questions, while phosphoproteomics studies could illuminate downstream signaling events. Single-molecule techniques could provide insights into oligomerization behavior in the membrane environment.

Physiological and Pathological Relevance:

  • What is the role of Lsmem1 in development and tissue homeostasis?

  • Are there associations between Lsmem1 variants and human diseases?

  • Could Lsmem1 serve as a diagnostic biomarker or therapeutic target?

  • How does Lsmem1 function compare across species?

Genetic association studies examining Lsmem1 polymorphisms in human populations could reveal disease connections, while comparative genomics approaches would illuminate evolutionary conservation and divergence in function.

Methodological Advances Needed:

  • Development of specific antibodies against different Lsmem1 isoforms

  • Improved techniques for functional studies of membrane proteins

  • Tissue-specific conditional knockout models

  • High-throughput screening methods to identify modulators

The progress in understanding Lsmem1 biology will likely accelerate with technological advances in membrane protein research, including native mass spectrometry, high-resolution imaging techniques, and improved computational prediction methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.