Recombinant Mouse Consortin (Cnst)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cnst; Consortin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-711
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnst
Target Protein Sequence
MDDSDPPTYSLQIEPQDGCHPGDSVERRVTRLPSVSDENENQLAGDGPAGLTTSEGAMGR ATVSEQDSLNNNESFPSSCEAAPTENAENTPSEGPKDDPPSLGQDQKLPAKRSPRAKKSS PKSAPPGDAVPVMQTQNATSQAAGEEEAAGVNANDPPKAPALQPLFSLIRGEVAQMDSRA LPLFLHQVAETYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKAVQPRTVTP LRNSEKGFNGEDFEQLAKICTTHQDPLLSKLKTAPVEPSPERKSLARAIMSEEAVGTEAA AKEPEIETCPSTDPSGDRHEEEPQESSPGCHQMEWQTASPELPGTAGKDHTEELPSSTNA TLDLHTQSLETAGSRSGPAAASNACKDSSCVPAPPTEDHCGVARDPKVAPPSESVAEQKL STGDDGALPGLISEGKYSQAHRKELCLPLQDAFEALPRDQPHSSEVAEPRQPDVTASDGK SAQSQAGLETGPESALCGDRKACDVSTLCLEVCMAPEERRDSEDRVSKETEDYLHSLLER CLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQEDLPPDESTLSLDDLAKKIEIAEAI PAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGGSCILLILLCIA TVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWVYLS
Uniprot No.

Target Background

Function
Essential for targeting connexins to the plasma membrane.
Gene References Into Functions
  1. Consortin acts as a trans-Golgi network cargo receptor, facilitating the plasma membrane targeting and recycling of connexins. PMID: 19864490
Database Links
Protein Families
CNST family
Subcellular Location
Cell membrane; Single-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle.

Q&A

What is Mouse Consortin (Cnst) and what are its primary cellular functions?

Consortin (CNST) is a trans-Golgi network (TGN) cargo receptor protein that plays a critical role in targeting transmembrane proteins to the plasma membrane. The protein functions primarily as a binding partner for connexins, facilitating their plasma membrane targeting and recycling. Mouse Consortin directly interacts with TGN clathrin linkers GGA1 and GGA2, which are essential components of the cellular trafficking machinery .

The protein exists in multiple isoforms, with the short isoform containing specific sorting signals, notably the DSDLL sequence that functions as a DXXLL sorting motif critical for proper trafficking function. Experimental evidence demonstrates that mutation of this motif (e.g., DSDLL to NSDAA) disrupts connexin trafficking while maintaining the protein-binding capabilities of Consortin . This indicates Consortin's dual role in both binding cargo proteins and recruiting trafficking adaptors.

How is Consortin gene expression regulated in normal and pathological conditions?

Consortin expression varies significantly depending on cell differentiation status and pathological conditions. In the hematopoietic system, CNST expression inversely correlates with cellular differentiation, showing highest expression in less differentiated cells, particularly leukemia stem cells (LSCs) .

Which experimental mouse models are recommended for studying Consortin function?

Several mouse model systems are suitable for Consortin research:

  • Gene-specific knockout models: Traditional Cnst knockout mice can be developed using CRISPR/Cas9 technology for whole-body or conditional tissue-specific deletion studies.

  • BXD Recombinant Inbred (RI) mice: These mice represent a genetic reference population derived from crossing C57BL/6J and DBA/2J mouse strains for over 20 generations, resulting in at least 99% inbred status . BXD RI mice are particularly valuable for studying gene-environment interactions and can help identify genetic determinants that may influence Consortin expression or function.

  • Collaborative Cross (CC): This large panel of multiparental recombinant inbred mouse lines was designed to overcome limitations of existing mouse genetic resources by modeling the complexity of the human genome . CC mice support analyses of complex phenotypes resulting from interactions between allele combinations and environmental factors, making them suitable for studying Consortin in complex disease contexts.

When selecting a model, consider the specific research question, as certain BXD RI strains may provide unique innate characteristics more suitable for particular experimental objectives .

What are the most effective methods for producing recombinant mouse Consortin protein?

Based on published methodologies, recombinant mouse Consortin can be effectively produced using the following approach:

  • Expression system selection: E. coli has been successfully used to produce recombinant GST-consortin fusion proteins that retain functional binding to connexins . The pGEX vector system is commonly employed for GST-fusion protein expression.

  • Construct design considerations:

    • Full-length constructs containing the transmembrane domain

    • Truncated versions (e.g., GST-consortin-ΔCter) lacking the transmembrane domain and C-terminal segment

    • Site-directed mutagenesis variants (e.g., DSDLL to NSDAA) to study specific functional domains

  • Purification protocol:

    • Bacterial lysis under native conditions

    • Affinity purification using glutathione sepharose

    • Size exclusion chromatography for higher purity

    • Validation of purified protein by SDS-PAGE and western blotting

The choice between full-length and truncated versions depends on the experimental application. Notably, truncated GST-consortin-ΔCter retains the ability to interact with connexins in pulldown assays, demonstrating that the transmembrane domain is not essential for connexin binding .

How can researchers effectively detect endogenous Consortin in experimental systems?

Detection of endogenous Consortin requires specific methodological approaches:

  • mRNA detection: RT-PCR has successfully detected Consortin gene expression (human CNST, mouse Cnst) in various cell types including HeLa cells .

  • Protein detection by immunoblotting:

    • Commercial antibodies against human and mouse Consortin are available

    • Custom antibodies can be raised against specific peptide regions of Consortin

    • Verification of antibody specificity is critical through:

      • Immunoblotting against cells expressing tagged Consortin variants

      • Antigen absorption assays

      • Comparison with knockout/knockdown controls

  • Subcellular localization:

    • Immunofluorescence microscopy using verified antibodies

    • Co-localization with TGN markers (e.g., TGN46, GM130)

    • Live-cell imaging using fluorescently tagged Consortin

When developing detection protocols, it is important to consider that Consortin exists in multiple isoforms, which may require isoform-specific detection strategies for comprehensive analysis .

What experimental approaches effectively demonstrate Consortin's role in connexin trafficking?

Several complementary experimental approaches can effectively demonstrate Consortin's role in connexin trafficking:

  • Protein-protein interaction assays:

    • GST pulldown assays using recombinant GST-consortin with in vitro-synthesized connexins

    • Co-immunoprecipitation of endogenous or tagged proteins

    • Proximity ligation assays for detecting interactions in situ

  • Functional perturbation studies:

    • Expression of dominant negative Consortin (NSDAA-consortin)

    • siRNA/shRNA-mediated knockdown of Consortin

    • Comparison with dominant negative GGA mutants (GGA1 VHS-GAT and GGA2 VHS-GAT)

  • Trafficking analysis:

    • Quantification of connexin plaques at cell-cell contacts

    • Measurement of intracellular connexin accumulation

    • Co-localization with Golgi markers (e.g., GM130)

These approaches have demonstrated that Consortin knockdown induces up to 90% reduction in connexin plaques at cell-cell contacts with massive intracellular accumulation of connexins. Similarly, expression of NSDAA-consortin (with mutated DXXLL sorting signal) results in intracellular accumulation of connexins despite retaining binding capability .

How does Consortin interact with the cellular trafficking machinery?

Consortin's interaction with cellular trafficking machinery involves several key components:

  • Adaptor protein interactions:

    • Direct binding to GGA1 and GGA2 adaptors via the DSDLL motif

    • The DXXLL sorting signal is critical for proper function, as mutation to NSDAA disrupts trafficking while preserving connexin binding

  • Clathrin-dependent mechanisms:

    • GGA proteins serve as clathrin linkers at the TGN

    • Dominant negative GGA mutants that cannot recruit clathrin inhibit GGA-dependent coat assembly

  • Additional adaptor recruitment:

    • Evidence suggests Consortin may recruit adaptors beyond GGAs, as dominant negative GGA mutants do not fully recapitulate the Consortin knockdown phenotype

A complex model emerges wherein Consortin functions as both a cargo receptor (binding connexins) and an adaptor-recruiting platform (interacting with GGAs and potentially other adaptors) to facilitate efficient connexin trafficking from the TGN to the plasma membrane.

What is the evidence linking Consortin dysfunction to human diseases?

Current evidence links Consortin to several pathological conditions:

These disease associations highlight Consortin as a potential therapeutic target, particularly in connexin-related diseases and hematological malignancies.

How can genetic variation in Consortin be studied using advanced mouse models?

Advanced mouse models offer sophisticated approaches to study Consortin genetic variation:

  • BXD Recombinant Inbred mouse panels:

    • Represent genetic reference populations derived from C57BL/6J and DBA/2J mouse strains

    • Over 20 generations of inbreeding ensures at least 99% genetic homogeneity within each strain

    • Enable studies of gene-environment interactions affecting Consortin function

    • Allow mapping of quantitative trait loci (QTLs) that influence Consortin expression or activity

  • Collaborative Cross (CC) model system:

    • Provides high and uniform genome-wide genetic variation

    • Supports integration of data across environmental and biological perturbations

    • Allows for reproducible population studies with controlled genetic backgrounds

    • Particularly valuable for studying complex disease traits that may involve Consortin

  • Experimental application strategies:

    • Phenotypic screening across BXD or CC strains to identify natural variations in Consortin function

    • Correlation of Consortin expression/function with disease-relevant phenotypes

    • QTL mapping to identify genetic modifiers of Consortin activity

    • Systems genetic approaches to place Consortin in broader biological networks

These genetic reference populations enable researchers to study natural variation in Consortin within controlled genetic backgrounds, facilitating the discovery of genetic modifiers and contextual factors that influence Consortin function in health and disease.

What methodological considerations are important when using Consortin knockout or modification approaches?

When implementing Consortin knockout or modification approaches, researchers should consider several methodological factors:

  • Knockout strategy selection:

    • Complete gene knockout vs. conditional tissue-specific deletion

    • CRISPR/Cas9-based approaches for precise genomic editing

    • Consideration of potential compensatory mechanisms in complete knockouts

  • Knockdown approaches:

    • siRNA/shRNA combinations have demonstrated effective Consortin knockdown

    • Verification of knockdown efficiency through both mRNA and protein analysis

    • Use of multiple independent siRNA/shRNA sequences to confirm specificity

  • Dominant negative approaches:

    • NSDAA-consortin (mutated DSDLL motif) serves as an effective dominant negative

    • Confirms separation of connexin binding from trafficking functions

    • Less disruptive than complete absence of protein

  • Phenotypic analysis considerations:

    • Assessment of connexin localization and function

    • Evaluation of gap junction communication

    • Investigation of downstream cellular effects (e.g., calcium signaling)

    • Potential developmental or tissue-specific phenotypes

  • Controls and validation:

    • Use of rescue experiments to confirm specificity

    • Comparison with other trafficking pathway components (e.g., GGA proteins)

    • Combined approaches (e.g., knockdown with dominant negative expression)

These considerations ensure robust and interpretable results when manipulating Consortin expression or function in experimental systems.

How can molecular interaction studies advance our understanding of Consortin's role in protein trafficking?

Advanced molecular interaction studies can significantly enhance our understanding of Consortin function:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of Consortin alone or in complex with binding partners

    • NMR studies of specific domains (e.g., the connexin-binding region)

    • In silico modeling of protein-protein interactions

  • Protein-protein interaction mapping:

    • Yeast two-hybrid screening to identify novel Consortin interactors

    • Proximity-dependent biotinylation (BioID, TurboID) to map the Consortin interactome

    • Quantitative proteomics of Consortin complexes under different conditions

    • FRET/BRET assays to study interactions in living cells

  • Domain mapping studies:

    • Creation of truncation and point mutation libraries

    • Peptide array mapping of interaction interfaces

    • Competition assays to determine binding hierarchies

  • Trafficking dynamics:

    • Live-cell imaging of fluorescently tagged Consortin and cargo proteins

    • RUSH (Retention Using Selective Hooks) system for synchronized trafficking studies

    • Super-resolution microscopy to visualize Consortin-containing trafficking intermediates

  • Systems-level analysis:

    • Integration of interactome data with transcriptomics and phenotypic information

    • Network analysis to position Consortin within broader trafficking pathways

    • Multi-omics approaches to understand context-dependent functions

These advanced approaches would provide deeper insights into how Consortin functions within the complex cellular trafficking machinery, potentially revealing new therapeutic targets or biomarkers for connexin-related diseases.

What are the most promising future research directions for Consortin studies?

Based on current knowledge and remaining gaps, several promising research directions emerge:

  • Expanded disease relevance investigation:

    • Further exploration of Consortin's role in leukemia progression and stem cell biology

    • Investigation of Consortin in additional connexin-related diseases (hearing loss, cardiac arrhythmias, peripheral neuropathies)

    • Assessment of Consortin as a potential therapeutic target or biomarker

  • Comprehensive cargo specificity analysis:

    • Systematic identification of all transmembrane proteins trafficked by Consortin

    • Elucidation of cargo recognition determinants and specificity mechanisms

    • Investigation of tissue-specific trafficking roles

  • Integration with cellular signaling networks:

    • Exploration of how Consortin trafficking is regulated by cellular signaling

    • Investigation of potential roles in cell-cell communication beyond connexin trafficking

    • Examination of Consortin in specialized cell types (neurons, stem cells)

  • Therapeutic development:

    • Design of small molecules or peptides that modulate Consortin-dependent trafficking

    • Development of strategies to normalize Consortin expression in diseases where it is dysregulated

    • Exploration of Consortin as a drug delivery target for specific cell populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.