Recombinant Mouse Cutaneous T-cell lymphoma-associated antigen 5 homolog (Ctage5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-779
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ctage5
Target Protein Sequence
MRADFNPSGFSLELAVCVLSVGLLAVVLFLWRGFRSIRSRFYVGREKKLALELSALIEEK CKLLDKVSIVQKEYEGLESSLKEASFEKESTEAQSLEFVEGSQISEATYENLEQSKSKLE DEILLLEEKLEEERAKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKTTFRIFEINEE RLKGAIKDALNENSQLQESQKQLLQETEMMKEQVNDLDKQKVALEESRAQAEQALSEKES QIETLVTSLLKMKDWAAVLGEDIADDGNLDLDMKSGLENTAALDNQPKGALKKLIYAAKL NASLKALEGERNQVYTQLSEVDQVKEDLTEHIKSLESKQASLQSEKTEFESESQKLQQKL KVITELYQENEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETCRQRAKDLEEEL ERTIHSYQGQVISHEKKAHDNWLAARTLERNLNDLRKENAHNRQKLTETEFKFELLEKDP YALDVPNTAFGREHSPYGPSPLGRPPSETRAFLSPPTLLEGPLRLSPLLPGGGGRGSRGP ENLLDHQMNTERGESSYDRLSDAPRAPSDRSLSPPWEQDRRMTAHPPPGQPYSDPALQRQ DRFYPNSGRLSGPAELRSYNMPSLDKVDGPVPSEMESSGNGTKDNLGNSNVPDSPIPAEC EAAGRGFFPPPFPPVRDPLFPVDPRSQFMRRGPSFPPPPPGSIYAAPRDYFPPRDFPGPP LPPFPGRTVYAPRGFPPYLPPRAGFFPPPPHPESRSELPPDLIPPSKEPAADPPETQEA
Uniprot No.

Q&A

What is Ctage5 and what are its main cellular functions?

Ctage5 (Cutaneous T-cell lymphoma-associated antigen 5 homolog), also known as MEA6, is a specialized cargo receptor localized at the endoplasmic reticulum (ER) that functions with Coat Protein Complex II (COPII) coats to facilitate trafficking of bulky cargo molecules. Its primary functions include:

  • Facilitation of protein secretion, including very low density lipoproteins and insulin

  • Transport of cellular (nonsecretory) components

  • Critical involvement in neural development and brain function

  • Mediation of lipoprotein trafficking from the embryonic yolk in zebrafish models

  • Remodeling of ER-exit sites and participation in the ER-Golgi intermediate compartment (ERGIC)

Ctage5 works both independently and cooperatively with Tango1, another cargo receptor, to mediate these various cellular functions, with divergent roles in different tissue types .

How is Ctage5 expression regulated in normal tissues versus disease states?

Expression analysis using reverse transcription polymerase chain reaction has revealed a distinct expression pattern of Ctage5:

  • In normal tissues: cTAGE-5A expression is primarily restricted to testis, with limited expression in other normal tissues

  • In disease states: cTAGE-5A and cTAGE-5B are detectable in various tumor tissues and cell lines, including cutaneous T cell lymphoma, melanoma, head and neck squamous cell carcinoma, breast carcinoma, and colon carcinoma

Tumor-specific protein expression of cTAGE-5 has been confirmed by Western blotting, and sero-reactivity against cTAGE-5A and cTAGE-5B is found predominantly in tumor patients (cutaneous T cell lymphoma and melanoma) . This restricted expression pattern suggests Ctage5 may function as a cancer germline antigen, with potential implications for tumor-specific immunotherapy approaches .

What phenotypes result from Ctage5 deficiency in animal models?

Ctage5 knockout models demonstrate severe developmental defects across multiple systems:

  • Neural system: Brain-specific conditional knockout (cKO) of cTAGE5/MEA6 in mice leads to severe neural developmental defects, postnatal lethality (before P25), and significantly reduced brain and body sizes

  • Cardiovascular system: Ctage5 mutant cells in the heart show elevated ER stress and morphological abnormalities

  • Gastrointestinal system: Intestinal cells lacking Ctage5 display increased stress pathway activation

  • Muscular system: Muscle abnormalities and elevated stress markers are observed in Ctage5-deficient models

  • Metabolic function: Complete disruption of lipoprotein trafficking from the yolk into zebrafish embryos

These phenotypes can be rescued by transgenic expression of human FLAG-hcTAGE5, confirming the specific role of Ctage5 deficiency in causing these developmental abnormalities .

How do the molecular interactions between Ctage5 and Tango1 regulate cargo specificity in vesicular trafficking?

The molecular interplay between Ctage5 and Tango1 demonstrates both cooperative and divergent functions in cargo trafficking:

  • Cargo selectivity: While both proteins facilitate bulky cargo export from the ER, Tango1 plays a primary role in collagen trafficking, whereas Ctage5 is more important for lipoprotein trafficking

  • Interaction mechanisms: Ctage5 and Tango1 may function as homo- and heterodimers at ER exit sites (ERES), with different combinations potentially mediating different trafficking functions

  • ER subdomain organization: Even when expressed at similar levels, one protein may predominate at specific ERES subdomains, with different domains specialized for different secretory cargoes

The specific interactions of these proteins with COPII components likely determine cargo selection and vesicle formation. While disruption of both genes compounds phenotype severity in model organisms, the individual deletion of either factor reveals tissue-specific defects, suggesting complementary but non-redundant functions .

What mechanisms explain Ctage5's role in neuronal development and how do these relate to Fahr's disease pathogenesis?

Ctage5/MEA6 is essential for neural development through several interconnected mechanisms:

  • Vesicular trafficking: Ctage5 facilitates the transport of essential neuronal cellular components during development

  • Stress pathway activation: Neuronal stress is significantly elevated upon Ctage5 deletion

  • ER-Golgi morphology: Ctage5 helps maintain proper ER-Golgi architecture and function in neurons

Regarding Fahr's disease, a rare neurologic disorder characterized by abnormal calcium deposits in the brain:

  • The CTAGE5 variant P521A has been identified as a risk factor for Fahr's disease

  • Mouse models with brain-specific deletion of Ctage5/MEA6 show severe neural developmental defects that may provide insight into disease mechanisms

  • The neuronal stress observed in Ctage5-deficient models suggests potential pathways through which CTAGE5 mutations could contribute to neurodegeneration in Fahr's disease

These findings highlight Ctage5's critical role in maintaining neuronal homeostasis and suggest potential therapeutic targets for Fahr's disease and other neurological disorders associated with CTAGE5 mutations.

How does Ctage5 contribute to autophagy and cellular stress responses?

Ctage5 demonstrates significant involvement in cellular stress responses through multiple pathways:

  • Autophagosome formation: Ctage5 plays a specific role in autophagosome formation, with Ctage5 mutants showing increased lysosomal volume, suggesting compensatory up-regulation of lysosome-mediated protein degradation

  • ER stress modulation: Cells lacking Ctage5 show elevated ER stress markers, particularly in tissues with high secretory demands

  • ERGIC remodeling: Ctage5 remodels ER-exit sites and plays a role in the ER and ERGIC, creating an autophagy supply pathway

Interestingly, these functions appear to be Ctage5-specific, as Tango1 mutants do not show changes in lysosomal volume, suggesting a unique role for Ctage5 in autophagy regulation . This function may be particularly important in tissues with high metabolic demands or those requiring extensive protein trafficking, such as neurons, muscle, and intestinal cells.

What are the optimal techniques for genetically manipulating Ctage5 expression in model organisms?

Based on successful approaches in the literature, several techniques are effective for Ctage5 genetic manipulation:

  • Conditional knockout approach: Using Cre-loxP system with loxP sites flanking critical exons (e.g., the 11th exon of Ctage5) combined with tissue-specific Cre expression (e.g., Nestin-Cre for brain-specific deletion)

  • CRISPR/Cas9-based methods: Homologous recombination to generate targeted mutations or conditional expression systems

  • Transgenic rescue experiments: Creation of human FLAG-Ctage5 conditional transgenic models inserted at specific genomic locations (e.g., Rosa26 locus) using CRISPR/Cas9 and homologous recombination

  • Point mutation models: Generation of specific variants (e.g., P521A) to study disease-associated mutations

For zebrafish models, deletion mutations in ctage5 have been successfully used to study tissue-specific functions, particularly in comparison with tango1 mutations to elucidate differential functions .

What experimental methods can effectively distinguish between Ctage5 and Tango1 functions in different tissues?

To differentiate between Ctage5 and Tango1 functions, researchers have employed several comparative approaches:

  • Genetic interaction studies: Creating single mutants (ctage5 or tango1) and double mutants to compare phenotypic severity and identify complementary versus unique functions

  • Tissue-specific analyses: Examining phenotypes across multiple organ systems (neural, cardiac, muscular, intestinal) in different genetic backgrounds

  • Cargo trafficking assays: Direct comparison of collagen versus lipoprotein trafficking in the same model organism with different genetic manipulations

  • Stress pathway activation markers: Analyzing differential activation of ER stress, UPR, and lysosomal pathways between Ctage5 and Tango1 mutants

  • Electron microscopy: Evaluating ultrastructural differences in ER-Golgi morphology and vesicular compartments between different mutant conditions

These approaches have revealed that while Ctage5 and Tango1 share some functions, they play distinct roles in different tissues and cargo types, with Tango1 being more critical for collagen trafficking and Ctage5 having a primary role in lipoprotein trafficking and autophagosome formation .

What are the recommended protocols for detecting Ctage5 expression and localization in different experimental contexts?

For effective detection and localization of Ctage5 in experimental settings:

Protein Expression Detection:

  • Western blotting: Effective for confirming tumor-specific protein expression of Ctage5 and distinguishing between different splice variants

  • Immunohistochemistry: Useful for tissue-specific localization studies, particularly in comparing normal versus pathological samples

Gene Expression Analysis:

  • RT-PCR: Demonstrated effectiveness for distinguishing between different cTAGE splice variants and their tissue-specific expression patterns

  • Expression analysis can differentiate between cTAGE-5A (restricted to testis and tumor tissues) and other variants with broader tissue distribution

Subcellular Localization:

  • Immunofluorescence microscopy: For visualizing Ctage5 localization at ER exit sites and examining co-localization with other trafficking components

  • ER subdomain analysis: To investigate potential concentration of Ctage5 or Tango1 at specific ER domains related to cargo specificity

Functional Assays:

  • Lipoprotein trafficking studies: Particularly effective in zebrafish models to visualize and quantify the movement of lipids from yolk to embryo tissues

  • Stress pathway reporters: To monitor activation of ER stress or autophagy pathways in response to Ctage5 manipulation

How can Ctage5 be targeted in cancer research and what is its potential as an immunotherapy target?

Ctage5's restricted expression pattern and immunogenic properties make it a promising target for cancer research:

  • As a cancer germline antigen: cTAGE-1 and cTAGE-5 function as cancer germline antigens with expression restricted primarily to testis and tumor tissues

  • Tumor specificity: cTAGE-5A and cTAGE-5B are detectable in multiple tumor types including cutaneous T cell lymphoma, melanoma, head and neck squamous cell carcinoma, breast carcinoma, and colon carcinoma

  • Immunogenicity: Sero-reactivity against cTAGE-1, cTAGE-4, cTAGE-5A, and cTAGE-5B has been found specifically in tumor patients (cutaneous T cell lymphoma and melanoma)

  • Epitope mapping: The immunogenic epitope of cTAGE-1 has been determined using epitope mapping and sera from cutaneous T cell lymphoma patients

These characteristics suggest Ctage5 could be a viable target for cancer immunotherapy approaches. The tumor-specific splicing of cTAGE genes may lead to candidate proteins for specific immunotherapy of cutaneous T cell lymphoma and other malignancies .

What is the significance of Ctage5 variants in neurological disorders beyond Fahr's disease?

While Fahr's disease has a documented association with the CTAGE5 P521A variant , research suggests broader neurological implications:

  • Developmental neurological disorders: Brain-specific deletion of Ctage5/MEA6 in mice leads to severe neural developmental defects, suggesting potential involvement in congenital neurological conditions

  • Neuronal stress pathways: The significant neuronal stress observed with Ctage5 deletion, which is exacerbated with concurrent Tango1 deletion, suggests potential roles in neurodegenerative disorders characterized by stress pathway activation

  • Cargo trafficking defects: Given Ctage5's role in vesicular trafficking, variants could potentially impact other neurological disorders where protein trafficking is compromised

The discovery that Ctage5 is essential for neural development and brain function suggests that variations in this gene could contribute to a spectrum of neurological disorders, particularly those characterized by developmental abnormalities or defects in cellular trafficking pathways.

How does Ctage5 function differ between embryonic development and adult tissue homeostasis?

The research indicates distinct roles for Ctage5 across developmental stages:

Embryonic Development:

  • Neural development: Critical for brain formation and neuronal network establishment

  • Lipoprotein trafficking: Essential for movement of lipids from yolk to developing tissues in zebrafish embryos

  • Organogenesis: Important for proper development of heart, muscle, lens, and intestine

Adult Tissue Homeostasis:

  • Maintenance of ER-Golgi morphology and function in mature tissues

  • Regulation of autophagy and cellular stress responses

  • Continued importance in tissues with high secretory demands

The temporal requirements for Ctage5 appear to shift from critical developmental functions to maintenance roles in adult tissues. This transition may explain why some Ctage5-associated disorders manifest during development (e.g., neural developmental abnormalities) while others may emerge later in life (e.g., certain aspects of Fahr's disease or malignancies) .

What cellular pathways beyond vesicular trafficking might involve Ctage5 function?

Recent research suggests Ctage5 involvement in additional cellular pathways:

  • Autophagy regulation: Ctage5 plays a specific role in autophagosome formation and creates an autophagy supply pathway through the ER and ERGIC

  • Stress response modulation: Ctage5 deficiency leads to elevated stress markers in multiple tissues, suggesting broader roles in cellular homeostasis beyond trafficking

  • Cell type-specific functions: Different proportions of Ctage5 may localize to different ER subdomains in different cell types, potentially mediating varied functions beyond canonical trafficking roles

These findings suggest Ctage5 may function as a multifunctional adaptor protein integrating various cellular processes related to protein quality control, stress responses, and organelle homeostasis in addition to its established roles in vesicular trafficking.

How might comparative analysis of Ctage5 function across species inform therapeutic approaches?

Cross-species analysis of Ctage5 provides valuable insights with therapeutic implications:

  • Conservation of function: Studies in zebrafish demonstrate that many Ctage5 functions are evolutionarily conserved, validating the use of model organisms for studying human CTAGE5-related disorders

  • Species-specific adaptations: Differences in Ctage5 function between species may highlight adaptations that could inform therapeutic approaches

  • Zebrafish as a model system: The zebrafish model has proven valuable for assessing candidate disease variants in human CTAGE5 and could continue to serve as a platform for therapeutic development

Recent identification of homozygous hypomorphic coding mutations in human TANGO1 resulting in collagen secretion defects, short stature, skeletal and neuronal defects, and insulin-dependent diabetes further emphasizes the value of comparative analyses between Tango1 and Ctage5 across species .

What technological advances would most benefit future Ctage5 research?

Several technological developments would significantly advance Ctage5 research:

  • High-resolution imaging techniques: To better visualize ER subdomain organization and the dynamic interactions between Ctage5, Tango1, and COPII components during vesicle formation

  • Tissue-specific and inducible genetic models: To distinguish between developmental versus maintenance functions of Ctage5 in different tissues

  • Proteomics approaches: To identify the complete interactome of Ctage5 in different tissue contexts and understand its varied functions

  • Patient-derived models: Development of cellular models from patients with CTAGE5 mutations to study pathogenic mechanisms and test therapeutic approaches

  • Gene therapy approaches: For potential correction of CTAGE5 mutations associated with neurological disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.