Recombinant Mouse CX3C chemokine receptor 1 (Cx3cr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
Cx3cr1; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; mCX3CR1; Fractalkine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNS RKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFF ITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDY PEVLQEMWPVLRNSEVNILGFALPLLIMSFCYFRIIQTLFSCKNRKKARAVRLILLVVFA FFLFWTPYNIMIFLETLKFYNFFPSCDMKRDLRLALSVTETVAFSHCCLNPFIYAFAGEK FRRYLGHLYRKCLAVLCGHPVHTGFSPESQRSRQDSILSSFTHYTSEGDGSLLL
Uniprot No.

Target Background

Function
CX3C chemokine receptor 1 (CX3CR1) is a receptor for the chemokine fractalkine (CX3CL1), expressed on various early leukocyte populations. CX3CR1-CX3CL1 signaling exerts diverse effects across tissues, influencing immune responses, inflammation, cell adhesion, and chemotaxis. Key roles include mediating cell migration, recruiting natural killer (NK) cells to inflamed sites, regulating atherogenesis through macrophage and monocyte recruitment, modulating airway inflammation by affecting Th2 cell survival, guiding monocyte migration to non-inflamed tissues for differentiation into macrophages and dendritic cells, negatively regulating angiogenesis, and playing a crucial role in brain microglia, impacting inflammatory responses in the central nervous system (CNS), synapse maturation, and synaptic pruning during brain development. Further, CX3CR1 significantly regulates the gut microbiota by controlling immunity to intestinal bacteria and fungi, notably through lamina propria dendritic cells in the small intestine and mononuclear phagocytes (MNPs) in antifungal immune responses. Additionally, CX3CR1 acts as a receptor for CCL26, inducing cell chemotaxis.
Gene References Into Functions
  1. CXCR1 mediates neuronal apoptotic cell death in ischemia. PMID: 29323156
  2. Sex differences in microglial activation modulate energy homeostasis, with CX3CR1 signaling as a potential therapeutic target for obesity. PMID: 28223698
  3. Angiotensin II upregulates CX3CR1 expression in vascular smooth muscle cells (VSMCs) via NADPH oxidase/ROS/p38 MAPK pathway; the CX3CL1/CX3CR1 axis contributes to Angiotensin II's proliferative and pro-inflammatory effects in VSMCs. PMID: 29356931
  4. CX3CR1 ablation enhances the neurotrophic action of microglia in Mecp2KO mice. PMID: 26883520
  5. Emotional and cognitive stress resilience involves CX3CR1-dependent basal and stress-induced alterations in hippocampal transcription. PMID: 27890560
  6. CX3CR1 deletion suggests a susceptibility-inducing role in developmental dysplasia of the hip. PMID: 29126427
  7. In Cx3cr1(-/-) mice, adult-born granule cells exhibit reduced spine density, dynamics, and size, with reduced contacts between microglia and dendritic shafts, and increased proportion of microglia-contacted spines. PMID: 29251592
  8. CX3CR1 is a novel target for extracellular Tau clearance. PMID: 28810892
  9. Fractalkine-CX3CR1 signaling has heterogeneous roles in specific brain regions and life stages. PMID: 28836393
  10. CX3CL1-CX3CR1 signaling modulates microglial-mediated degeneration. PMID: 27314452
  11. Increased fractalkine and CX3CR1 cause cross-talk between activated glial cells and neurons in neuroinflammation in fructose-fed mice. PMID: 26765996
  12. CX3CR1 deficiency accelerates vascular pathology in diabetic retinopathy. PMID: 27344677
  13. CX3CR1(-/-) mice show resistance to chronic stress-induced mood alterations, with increased energy expenditure potentially related to active coping behavior. PMID: 28736330
  14. Inflammatory osteoclasts prime TNFalpha-producing CD4(+) T cells and express CX3CR1. PMID: 27161765
  15. Functional CX3CR1 in macrophages plays a non-redundant role in controlling abnormal intestinal inflammation and preventing tissue damage. PMID: 27707514
  16. Fractalkine-CX3CR1 interaction is crucial for macrophage recruitment into brown adipose tissue of obese mice. PMID: 27417459
  17. CX3CR1 deletion in microglia modifies brain areas with elevated cellular turnover independent of CX3CL1. PMID: 27639555
  18. Following VEGF signaling blockade, CX3CL1 is upregulated, recruiting CX3CR1+Ly6Clo monocytes into tumors. PMID: 28691930
  19. The CX3CL1/CX3CR1 system is essential for restricting coxsackievirus B3-induced myocarditis. PMID: 28800592
  20. CX3CR1 in gut macrophages resolves intestinal inflammation and protects against colitis-associated cancer by regulating HMOX-1 expression. PMID: 28619710
  21. CX3CR1 significantly contributes to microglia morphology changes in the peri-infarct area after stroke; CX3CR1 deficiency does not affect lesion size or early functional outcome. PMID: 28061814
  22. CX3CR1 deletion promotes recovery after spinal cord injury by reducing macrophage-mediated injury and enhancing endogenous repair. PMID: 28264978
  23. CX3CR1 on resident vessel wall cells plays a key role in atherosclerotic plaque formation in transplanted aortic grafts. PMID: 28234900
  24. CX3CR1 knockdown or knockout causes decreased numbers of oligodendrocyte progenitor cells (OPCs) and oligodendrocytes in the postnatal cortex. PMID: 28472653
  25. Fractalkine-CX3CR1 signaling protects neurons. PMID: 27814376
  26. In experimental autoimmune encephalomyelitis, CX3CR1 deficiency alters infiltrated NK cell phenotype. PMID: 27325505
  27. CX3CL1-CX3CR1 plays a crucial role in intestinal leukocyte recruitment during murine colitis. PMID: 27942903
  28. CX3CR1 deficiency in CNS resident cells affects mouse survival, HSV-1 replication control, and cerebral inflammatory response; deficiency in the hematopoietic system does not. PMID: 27902351
  29. CX3cr1 deletion does not affect clinical signs or incubation period of prion disease. PMID: 26935332
  30. CX3CL1 and CX3CR1 interactions determine the number of M1 macrophages in the skin, affecting psoriasis-like inflammation. PMID: 26976687
  31. CX3CR1 disruption differentially influences dopaminergic neuron degeneration in Parkinsonian mice depending on neurotoxin and route of administration. PMID: 26403659
  32. Mononuclear phagocyte subsets are distinguished by CX3CR1 expression, which can be regulated using in vivo depletion and genetic targeting. PMID: 26705686
  33. CD11c(+) CX3CR1(+) F4/80(-) DCs significantly increase during intestinal schistosomiasis in the ileal lamina propria. PMID: 26303459
  34. Canonical Wnt signaling contributes to focal retinal degeneration in mouse models with Ccl2 and Cx3cr1 deficiency. PMID: 26476672
  35. CX3CR1 knockout decreases microglial phagocytosis, decreasing inflammation associated with alpha-syn internalization, suggesting importance in synucleinopathies. PMID: 26469270
  36. Icariin reduces CX3CR1 and CX3CL1 protein levels, suggesting potential as an anti-atherosclerosis agent. PMID: 26802470
  37. CX3CR1 modulates responses to mild TBI in a time-dependent manner. PMID: 26329692
  38. Dysregulated microglial responses in the absence of CX3CR1 contribute to inflammatory damage of neurons in the diabetic retina. PMID: 26514658
  39. Resident arterial macrophage survival depends on a CX3CR1-CX3CL1 axis. PMID: 26642357
  40. CX3CR1 is important for acute skeletal muscle injury repair by regulating macrophage phagocytosis. PMID: 26443824
  41. CX3CR1 deficiency promotes muscle repair and rescues Ccl2(-/-) mice from impaired muscle regeneration due to altered macrophage function, including upregulated Apolipoprotein E (ApoE). PMID: 26632270
  42. Fractalkine receptor CX3CR1 expression is decreased in murine and human glioblastoma (GBM) tissue. PMID: 25987130
  43. Myocardial fractalkine expression is increased in a myocardial infarction model. PMID: 26049921
  44. Cx3cr1-deficient mice are protected from Schistosoma japonicum egg-induced granuloma formation and hepatic injury. PMID: 26035381
  45. Neuronal Cx3cr1 may impact Alzheimer's disease-like pathology by modulating amyloid-beta-induced synaptotoxicity. PMID: 26038823
  46. Microbiota-mediated activation of innate immune responses through CX3CR1 controls steatohepatitis progression. PMID: 26178698
  47. CX3CL1/CX3CR1 signaling is involved in long-term potentiation (LTP) of C-fiber-evoked field potentials in the spinal dorsal horn. PMID: 25768734
  48. Fractalkine-CX3CR1 signaling pathway is implicated in limbic seizure-induced hippocampal pathologies. PMID: 25461978
  49. CX3CR1 deficiency does not affect monocyte trafficking or macrophage differentiation in renal obstruction but is required for increased fibrosis. PMID: 26254342
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in subsets of leukocytes: expressed in monocytes, subsets of T-cells and natural killer (NK) cells in the circulation, dendritic cells, as well as in microglia in the central nervous system (CNS). Expression level subdivides blood m

Q&A

What is Cx3cr1 and where is it primarily expressed?

Cx3cr1 is a G protein-coupled receptor that recognizes the chemokine CX3CL1 (fractalkine). While traditionally considered a microglial marker, significant expression has been documented in multiple immune cell populations. Recent studies have shown that CX3CR1 is prevalently expressed on KLRG1+ NK cells, particularly a subset considered to be terminally differentiated . This understanding is critical when designing experiments targeting specific cell populations, as Cx3cr1 expression is not exclusively limited to microglia as once thought.

How is CX3CR1 expression characterized in NK cells?

CX3CR1 expression defines distinct NK cell subsets with unique properties. Flow cytometric analysis of CX3CR1+/GFP mice has revealed that among CD3-/NK1.1+ NK cells, only discrete populations express CX3CR1-GFP in bone marrow (12% ± 3%), spleen (27% ± 4%), and liver (33% ± 8%) . CX3CR1 expression is developmentally regulated, with the mature KLRG1+ NK cell subset acquiring high expression levels of the receptor. Two KLRG1+ NK cell populations can be distinguished based on CX3CR1 expression, with distinct homing and functional features .

What methodologies are used to identify CX3CR1-expressing cells?

Researchers commonly employ several approaches to identify CX3CR1-expressing cells:

  • Genetically modified mouse models where the Cx3cr1 exon is replaced by GFP (CX3CR1+/GFP mice), allowing identification of CX3CR1-expressing cells as GFP+ cells

  • Surface expression analysis using human CX3CL1 fused with human-Fc (CX3CL1-Fc)

  • Flow cytometric analysis combining CX3CR1 detection with other lineage markers

  • Intracellular staining protocols following fixation with paraformaldehyde and permeabilization with saponin

What are the common Cx3cr1-Cre mouse lines and their specificity issues?

Several Cx3cr1-Cre lines have been developed for studying microglial function:

  • Constitutive Cx3cr1-cre line (Jung et al., 2000; Jackson Laboratory stock #025524) - reported to have significant leakage into neurons

  • MMRRC constitutive Cx3cr1-Cre line - reported to drive microglial-specific expression in most animals tested

  • BAC transgenic lines - two constitutive and two inducible Cx3cr1 promoter-driving cre lines created using BAC transgenic strategies

The specificity concerns with these lines are significant. Recent studies have reported that some Cx3cr1-Cre lines may have considerable leakage into neurons, while others have reported Cx3cr1 expression in non-microglial cells including neurons and astrocytes, either during brain development or upon neurological insult .

How can researchers validate Cx3cr1-Cre specificity for their experiments?

To validate Cx3cr1-Cre specificity:

  • Perform detailed immunohistochemical analysis using multiple cell-type-specific markers

  • Include appropriate reporter lines (e.g., tdTomato) to visualize Cre activity

  • Analyze multiple developmental timepoints to account for temporal specificity issues

  • Use complementary approaches such as RNA-seq or single-cell sequencing to confirm cell-type specificity

  • Consider using multiple Cx3cr1-Cre lines in parallel to compare results

These validation steps are crucial as the leakage into neurons varies among different Cx3cr1-cre lines and studies, raising concerns about the reliability of data generated in previous investigations .

What is known about CX3CR1-CX3CL1 interaction at the molecular level?

The interaction between CX3CR1 and its ligand CX3CL1 involves specific structural elements and binding sites. CX3CL1 recognition by CX3CR1 occurs at the chemokine recognition site 2 (CRS2), where the N-terminal hook (pE1-H2-H3-G4-V5-T6) of CX3CL1 reaches deep into the transmembrane helical core and forms extensive polar interactions with CX3CR1 .

Key interactions include:

  • A salt bridge between E254^6.58 of CX3CR1 and H3 of CX3CL1

  • Critical acidic residues in the receptor binding pocket that are essential for chemokine recognition

These molecular interactions have been verified through inositol phosphate (IP) accumulation assays using chimeric Gα proteins .

How does the structure of active CX3CR1 compare to other chemokine receptors?

The active CX3CR1 structure exhibits distinct conformational characteristics compared to other chemokine receptors:

  • CX3CR1 shows a smaller outward movement of helix VI at the intracellular side compared to CCR5 and US28

  • The intracellular end of helix VI in active CX3CR1 shows only a 2.3-Å outward movement (A^6.33 as reference), much smaller than in active CCR5 (8.2 Å) and G_i-bound US28 (6.7 Å)

  • This limited displacement results in a narrower space between the intracellular ends of helix III and helix VI

  • To accommodate Gα_i, helix VII and helix VIII of CX3CR1 shift away from the helical center, with a 5.8-Å outward movement of helix VII (Y^7.53 as reference) and a 3.7-Å shift of helix VIII (K^8.49 as reference)

This unique conformation results in a distinct G protein coupling mode, with the calculated coupling interface between G_i1 and CX3CR1 being approximately 900 Å^2, larger than that in CCR5-G_i (826 Å^2) and US28-G_i (790 Å^2) complex structures .

How can researchers study CX3CR1+ cell localization and trafficking in vivo?

To study CX3CR1+ cell localization and trafficking:

  • Adoptive transfer experiments: Label cells (e.g., with PKH-26) from CX3CR1+/GFP mice and transfer into wild-type recipients to track distribution patterns

  • Tissue-specific analysis: When examining bone marrow (BM) localization, distinguish between cells in the:

    • Parenchyma: Where KLRG1+/CX3CR1-GFP- and KLRG1- NK cells are mainly located

    • Sinusoids: Where the majority of KLRG1+/CX3CR1-GFP+ NK cells reside

  • Receptor manipulation: Study the role of other receptors in maintaining CX3CR1+ cells in specific niches (e.g., CXCR4/CXCL12 axis, α4 integrin)

Research has shown that CX3CR1-GFP+ NK cells distribute with lower frequency in the BM compared to spleen and liver, indicating tissue localization is regulated by homing behavior rather than microenvironment-induced CX3CR1 expression changes .

What experimental approaches are effective for studying CX3CR1 activation and signaling?

Several methodologies provide insights into CX3CR1 activation and signaling:

  • G protein-coupling studies: Using modified constructs with mutations (e.g., I120^3.43L, C221^ICL3S, M250^6.54V) to improve protein yield and thermostability while maintaining receptor activation properties

  • Functional assays:

    • Inositol phosphate (IP) accumulation assays using chimeric Gα proteins (Gα_qi5) to convert G_i-related signaling into a G_q readout

    • Interface verification through site-directed mutagenesis of key residues

  • Structural analysis techniques:

    • Cryo-electron microscopy to determine receptor-ligand complex structures

    • Model building and refinement using computational approaches

  • Cytokine production assays:

    • Intracellular staining for IFN-γ in CX3CR1-expressing cells following cytokine stimulation

    • Flow cytometric analysis to assess functional responses

How can researchers address potential artifacts in Cx3cr1-Cre experiments?

To minimize artifacts in Cx3cr1-Cre experiments:

  • Include appropriate controls:

    • Use Cre-negative controls

    • Compare results across multiple Cx3cr1-Cre lines

    • Verify findings with complementary approaches

  • Consider temporal specificity:

    • Evaluate developmental timing of Cre expression

    • Use inducible Cre systems to restrict activity to specific timepoints

  • Validate cell-type specificity extensively:

    • Perform co-labeling with multiple cell-type markers

    • Use single-cell approaches to confirm specificity

The lack of validated Cre lines that specifically target microglia represents a significant challenge to the field . Researchers should critically evaluate their experimental design to account for these limitations.

What are the key considerations for creating and validating CX3CR1 constructs?

When creating CX3CR1 constructs for expression and functional studies:

  • Receptor modifications:

    • Mutations like I120^3.43L and M250^6.54V can improve protein yield and thermostability

    • C221^ICL3S can prevent formation of potential mispairing disulfide bonds

    • Validate that modifications maintain receptor function through appropriate activity assays

  • Construct design for complex formation:

    • For studying CX3CR1-CX3CL1 complexes, connect the CX3CL1 C-terminus and CX3CR1 N-terminus with an appropriate linker (e.g., 28-residue 14×Gly-Ser)

    • Consider introducing disulfide cross-linking mutations to stabilize the complex (e.g., L176^ECL2C in CX3CR1 and G35C in CX3CL1)

  • Expression systems:

    • Insect cell expression systems (e.g., HighFive) can be effective for co-expression of CX3CR1 with G protein components

    • Use viral titers >10^9 viral particles/ml with appropriate multiplicity of infection ratios

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.