Recombinant Mouse Cyclic nucleotide-gated olfactory channel (Cnga2)

Shipped with Ice Packs
In Stock

Description

Functional Insights

CNGA2 channels mediate odorant signal transduction by converting cAMP/cGMP binding into cation influx, depolarizing olfactory sensory neurons . Key functional properties include:

  • Ligand Sensitivity: Activated by cGMP (EC₅₀ ~1 μM) and cAMP, with higher open probability in homotetramers .

  • Ion Permeability: Permeable to Na⁺, K⁺, and Ca²⁺ (P_Ca/P_Na = 6.8) . Ca²⁺ influx triggers adaptation via calmodulin binding .

  • Gating Mechanism: Homotetrameric CNGA2 activation involves three cooperative cAMP/cGMP binding steps, unlike heterotetrameric native channels .

Comparative Studies

  • Homomeric vs. Heteromeric Channels: Homotetrameric CNGA2 lacks modulatory subunits (CNGA4, CNGB1b), enabling isolation of alpha subunit contributions to ligand binding and gating .

  • Ligand Binding Kinetics: Rapid photolysis experiments revealed similar activation time courses for cGMP and cAMP in homotetramers, supporting a three-binding-site model .

Regulatory Mechanisms

  • PIP3 Inhibition: The N-terminus of CNGA2 is essential for phosphatidylinositol-3,4,5-trisphosphate (PIP3)-mediated channel inhibition .

  • Calmodulin Interactions: Unlike native heteromers, CNGA2 homomers are insensitive to Ca²⁺/calmodulin due to the absence of CNGA4 and CNGB1b subunits .

Technical Advantages

  • High Yield: E. coli expression ensures cost-effective production for large-scale studies .

  • Stability: Lyophilized form with trehalose enhances shelf life, minimizing aggregation .

  • Customization: Available in multiple formats (e.g., GST-tagged, biotinylated) for diverse experimental setups .

Key Research Findings

StudyKey ContributionCitation
Activation KineticsDemonstrated three cooperative ligand-binding steps in homotetrameric CNGA2 gating
PIP3 RegulationIdentified CNGA2 N-terminus as critical for PIP3-mediated channel inhibition
Structural ModelingResolved CNBD and P-loop roles in ion selectivity and ligand binding

Comparison with Orthologs

SpeciesSubunit CompositionLigand SensitivityRegulatory Features
MouseCNGA2 homotetramercGMP > cAMPPIP3-sensitive, Ca²⁺/calmodulin-insensitive
HumanCNGA2/CNGA4/CNGB1bEnhanced cAMP sensitivityCa²⁺/calmodulin-dependent adaptation
RatCNGA2/CNGA4/CNGB1bSimilar to human heteromersPIP3 and Ca²⁺/calmodulin co-regulation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during the production process. If you require a particular tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cnga2; Cncg2; Cncg4; Cyclic nucleotide-gated olfactory channel; Cyclic nucleotide-gated cation channel 2; Cyclic nucleotide-gated channel alpha-2; CNG channel alpha-2; CNG-2; CNG2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-664
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MMTEKSNGVKSSPANNHNHHPPPSIKANGKDDHRAGSRPQSVAADDDTSSELQRLAEMDT PRRGRGGFRRIVRLVGIIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGDGKGDKD GEGKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRNYFVVWLVL DYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAV GIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISK SIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFL IGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWT NKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTA NIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQ EKLEQLETNMETLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSDGINTPEP AVAE
Uniprot No.

Target Background

Function
Odorant signal transduction is likely mediated by a G-protein coupled cascade utilizing cAMP as a second messenger. The olfactory channel has been shown to be activated by cyclic nucleotides, leading to depolarization of olfactory sensory neurons.
Gene References Into Functions
  1. In Cnga2 knock-out mice, an overproduction of Amyloid beta protein, tau hyper-phosphorylation, and behavioral abnormalities were observed. PMID: 26377105
  2. This study revealed that Cnga2 mice exhibited increased anxiety- and depressive-like behaviors compared to their wild-type counterparts. PMID: 25192635
  3. Retinoic acid receptor and CNGA2 channel signaling are part of a regulatory feedback loop that controls axonal convergence and survival of olfactory sensory neurons. PMID: 22009938
  4. CNGA2 channels contribute to ATP-induced non-capacitative calcium influx in vascular endothelial cells. ATP likely acts through P2Y(1)receptors and adenylyl cyclases to stimulate CNGA2. PMID: 19729961
  5. Plays a significant role in odor discrimination and adaptation in behaving mice. PMID: 12649326
  6. Several odorants, including putative pheromones, are detected and discriminated behaviorally by CNGA2 knock-out mice. These odors elicit responses in the olfactory epithelium, main olfactory bulb, and olfactory (piriform) cortex. PMID: 15071119
  7. Mice lacking functional CNGA2, essential for odor-evoked MOE signaling, fail to mate or fight, indicating a broad and crucial role for the MOE in regulating these behaviors. PMID: 16261133
  8. Function in the nose is unique to the primary population of olfactory sensory neurons. PMID: 16481428
  9. CNGA2 channels are not necessary for either the response of GnRH-1 neurons to cAMP increases or the basal rhythmic activity of GnRH-1 neurons. PMID: 17916627
  10. CNGA2 channels play a critical role in adenosine-induced endothelial Ca(2+) influx and vasorelaxation. PMID: 18292397
  11. Mediates epinephrine-induced endothelial calcium influx and subsequent vascular dilation. PMID: 18621055

Show More

Hide All

Database Links

KEGG: mmu:12789

STRING: 10090.ENSMUSP00000006020

UniGene: Mm.5097

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGA2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is CNGA2 and what is its primary function in olfactory neurons?

CNGA2 is a subunit of cyclic nucleotide-gated (CNG) ion channels that plays a crucial role in olfactory signal transduction. In olfactory sensory neurons, odorant binding to receptors triggers an increase in intracellular cAMP, which directly opens CNG channels containing CNGA2 subunits. This allows calcium influx, which subsequently activates chloride currents, leading to depolarization and signal transmission. The channel serves as a direct molecular link between odorant detection and neuronal depolarization, making it essential for olfactory sensation .

What is the molecular structure of mouse CNGA2?

Mouse CNGA2 is a transmembrane protein with a molecular weight of approximately 76.2 kDa . The protein contains six transmembrane domains with intracellular N- and C-termini. The N-terminus contains regulatory regions, including a calcium-calmodulin binding domain (residues 68-81), which is critical for channel modulation. The C-terminus contains the cyclic nucleotide-binding domain that is responsible for channel activation upon cAMP/cGMP binding. The functional channel is typically formed as a heterotetramer with other subunits (CNGA4 and CNGB1b in olfactory neurons), although CNGA2 can form functional homomeric channels in heterologous expression systems .

How does CNGA2 contribute to broader neuronal functions beyond olfaction?

Beyond its well-established role in olfactory transduction, CNGA2 has been implicated in the modulation of neurotransmitter release and modification of synaptic strength. CNG channels, including those containing CNGA2, provide a voltage-independent mode of calcium entry into neurons, which can influence presynaptic activity. Research has shown that CNG channels modulate transmitter release in various neuronal systems, including retinal cone synapses and hypothalamic neuropeptide secretion. This suggests that CNGA2 may have broader neurophysiological roles in activity-dependent modulatory and adaptive changes in various neuronal populations .

What expression systems are most effective for recombinant CNGA2 studies?

HEK293 cells represent an established and efficient heterologous expression system for functional studies of recombinant CNGA2. This system allows for electrophysiological characterization of channel properties through patch-clamp recordings. For inside-out patch configurations, researchers can directly expose the intracellular face of expressed channels to varying concentrations of cyclic nucleotides and modulatory molecules to assess their effects on channel function . Cell-free protein synthesis (CFPS) systems have also been employed to produce recombinant CNGA2 for structural and biochemical studies with purification typically involving affinity chromatography using tags such as His-tag or Strep-tag . For more physiologically relevant studies, adenoviral or lentiviral expression in primary olfactory neuron cultures can be considered, though these present greater technical challenges.

How can CRISPR/Cas9 genome editing be applied to study CNGA2 function?

CRISPR/Cas9 technology offers powerful approaches to investigate CNGA2 function through targeted genetic modifications. Researchers can design guide RNAs targeting specific exons of the CNGA2 gene to generate various mutant alleles. For example, small insertions or deletions (indels) can create frameshift mutations leading to premature stop codons, effectively producing null alleles as demonstrated with "cnga2a-stop" alleles in zebrafish studies . Alternatively, dual guide RNA strategies can generate large in-frame deletions of specific functional domains, such as deletions of exons encoding regulatory regions, while maintaining the reading frame for the rest of the protein . Such domain-specific mutants allow for dissection of structure-function relationships. When applying CRISPR/Cas9 to mouse models, researchers should consider potential compensatory mechanisms from paralogous genes and design strategies to address functional redundancy, which might include generating double knockout models of multiple CNG channel subunits .

What are the critical considerations for antibody-based detection of CNGA2?

When employing antibodies for CNGA2 detection, researchers must exercise caution regarding potential cross-reactivity issues. Despite the apparent monospecificity of monoclonal antibodies, cross-reactivity with structurally unrelated proteins can occur, as dramatically demonstrated in zebrafish studies where an anti-CNGA2a monoclonal antibody (mAb L55/54) unexpectedly cross-reacted with oxytocin despite no sequence similarity . To ensure specificity, researchers should validate antibodies using multiple approaches, including Western blot analysis with recombinant protein expressed in heterologous systems as positive controls and genetic knockout samples as negative controls . For immunohistochemical applications, validation should include genetic knockout tissue sections alongside wild-type samples. Additionally, researchers should complement antibody-based detection with independent methods such as in situ hybridization or RNA sequencing to confirm expression patterns. When available, tagged recombinant versions of CNGA2 allow for detection using well-validated anti-tag antibodies, providing an alternative approach to circumvent specificity issues with direct CNGA2 antibodies .

What purification strategies yield highest quality recombinant CNGA2 for structural and biochemical studies?

Purification of recombinant CNGA2 for structural and biochemical studies requires careful consideration of expression systems and purification techniques to maintain protein integrity. For membrane proteins like CNGA2, mammalian expression systems such as HEK293 cells often provide proper folding and post-translational modifications, yielding >90% purity as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot and analytical SEC (HPLC) . Alternative approaches using cell-free protein synthesis (CFPS) systems can achieve 70-80% purity as assessed by similar analytical methods . Affinity purification using His-tag or Strep-tag followed by size exclusion chromatography represents an effective workflow. Critical quality control steps include verification of protein homogeneity by analytical size exclusion chromatography, assessment of functional integrity through cyclic nucleotide binding assays, and thermal stability analysis. For structural studies requiring highly homogeneous samples, additional purification steps such as ion exchange chromatography may be necessary to separate different oligomeric states or conformational variants of the channel.

How does phosphatidylinositol-3,4,5-trisphosphate (PIP3) regulate CNGA2 channel function?

PIP3 exhibits a significant inhibitory effect on CNGA2-containing channels through direct interaction with the N-terminal region of the CNGA2 subunit. Specifically, residues 61-90 within the N-terminus of CNGA2 are necessary for PIP3 regulation, as demonstrated through experiments with chimeric channels and deletion mutants . Biochemical "pulldown" assays suggest that PIP3 directly binds to this region. When applied to the intracellular face of excised patches from HEK293 cells expressing CNGA2-containing channels, PIP3 inhibits channel activation in response to cyclic nucleotides. Interestingly, this inhibitory effect extends to both homomeric CNGA2 channels and heteromeric olfactory CNG channels composed of CNGA2, CNGA4, and CNGB1b subunits . The inhibitory mechanism likely involves disruption of an autoexcitatory interaction between the N and C termini of adjacent subunits, which dramatically suppresses channel currents. This PIP3-mediated inhibition may generate shifts in odorant sensitivity that operate independently of prior channel activity, potentially serving as a mechanism for olfactory adaptation or modulation .

What is the relationship between calcium-calmodulin (Ca2+/CaM) and PIP3 in regulating CNGA2 channels?

The interplay between Ca2+/CaM and PIP3 represents a sophisticated regulatory mechanism for CNGA2 channel function. The N-terminus of CNGA2 contains a calcium-calmodulin (Ca2+/CaM) binding domain (residues 68-81) that mediates Ca2+/CaM inhibition of homomeric CNGA2 channels . Remarkably, this same region overlaps with the domain necessary for PIP3 regulation (residues 61-90). Experimental evidence demonstrates that PIP3 can occlude the action of Ca2+/CaM on both homomeric and heteromeric channels, partly by blocking Ca2+/CaM binding to the channel . This suggests competitive interaction between these two regulatory molecules at a shared or overlapping binding site. In physiological contexts, this competitive regulation may allow for integration of different signaling pathways—calcium-dependent processes via calmodulin and phosphoinositide signaling via PIP3—to fine-tune olfactory CNG channel activity. The balance between these regulatory mechanisms likely contributes to complex patterns of olfactory adaptation and sensitivity modulation in response to different cellular states and environmental stimuli .

How can researchers address antibody cross-reactivity issues when studying CNGA2?

Addressing antibody cross-reactivity requires a multi-faceted validation approach. The cautionary example from zebrafish studies where an anti-CNGA2a monoclonal antibody (mAb L55/54) cross-reacted with the structurally unrelated oxytocin neuropeptide highlights the importance of thorough validation . Researchers should implement the following strategies: (1) Validate antibodies using genetic knockout models alongside wild-type controls to definitively establish specificity—the cross-reactivity of mAb L55/54 was only discovered when oxytocin gene knockout eliminated the immunoreactivity while CNGA2 knockouts did not ; (2) Perform Western blot analysis with recombinant CNGA2 expressed in heterologous systems to confirm expected molecular weight recognition; (3) Complement antibody detection with orthogonal methods such as in situ hybridization to verify expression patterns; (4) Consider epitope mapping to identify the specific sequence recognized by the antibody; and (5) When possible, use multiple antibodies targeting different epitopes of CNGA2 to corroborate findings. For critical experiments, researchers might consider using tagged recombinant CNGA2 constructs that allow detection via well-validated anti-tag antibodies or developing genetic reporter systems that directly visualize CNGA2 expression without relying on antibodies .

How do evolutionary differences between mouse and zebrafish CNGA2 impact experimental design and data interpretation?

Evolutionary differences between mouse and zebrafish CNGA2 homologs require careful consideration in comparative studies. Zebrafish possess two paralogs of CNGA2 (cnga2a and cnga2b) resulting from the ancient ray-finned fish genome duplication, while mammals have a single CNGA2 gene . This genomic divergence necessitates several experimental considerations: (1) Functional redundancy between paralogous genes may mask phenotypes in single-gene knockout models, requiring double knockout approaches as demonstrated in zebrafish studies ; (2) Expression patterns may have diverged, with zebrafish showing more restricted expression of CNGA2 paralogs compared to the broader neuronal expression in mammals; (3) Antibody cross-reactivity risks differ between species, as exemplified by the unexpected cross-reactivity of anti-CNGA2a antibody with zebrafish oxytocin ; (4) Molecular interactions and regulatory mechanisms may have evolved differently, potentially altering interpretations of conserved functions; and (5) The developmental roles of CNGA2 might differ between vertebrate lineages. When designing experiments across species, researchers should use sequence homology analysis to identify conserved functional domains, validate reagents specifically for each species, and consider complementing animal model studies with direct comparative analysis of recombinant channels from different species expressed in the same heterologous system to isolate intrinsic functional differences .

What electrophysiological approaches are most effective for characterizing CNGA2 channel properties?

Patch-clamp electrophysiology represents the gold standard for functional characterization of CNGA2 channels. The inside-out patch configuration is particularly valuable as it allows direct application of cyclic nucleotides and regulatory molecules to the intracellular face of the channel while monitoring current responses in real-time . For recombinant expression, HEK293 cells provide a reliable heterologous system with low endogenous channel expression . Key experimental parameters to measure include: dose-response relationships for cAMP and cGMP activation; ion selectivity profiles; single-channel conductance; activation and deactivation kinetics; and modulation by regulatory factors such as PIP3 and Ca2+/CaM . When studying heteromeric channels, co-expression of CNGA2 with CNGA4 and CNGB1b subunits in defined ratios is essential to recapitulate native olfactory CNG channel properties. For higher-throughput screening of channel modulators, fluorescence-based assays using calcium-sensitive dyes in combination with automated plate readers can complement traditional electrophysiology. Additionally, voltage-clamp fluorometry techniques that simultaneously measure current and conformational changes using site-directed fluorophore labeling can provide insights into the coupling between ligand binding and channel gating .

What biochemical approaches can quantify interactions between CNGA2 and regulatory molecules?

Multiple biochemical techniques can effectively quantify interactions between CNGA2 and its regulatory molecules. Pull-down assays using recombinant N-terminal fragments of CNGA2 have successfully demonstrated direct binding of PIP3 to this region . For comprehensive interaction studies, researchers can employ: (1) Surface plasmon resonance (SPR) to measure binding kinetics and affinity constants between purified CNGA2 protein domains and regulatory molecules like PIP3 or calmodulin; (2) Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding; (3) Fluorescence polarization assays with labeled ligands to measure binding in solution; and (4) Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify specific regions involved in molecular interactions. For cellular contexts, techniques such as fluorescence resonance energy transfer (FRET) between tagged CNGA2 and regulatory proteins can reveal interactions in living cells and their modulation by cellular signaling. Additionally, cross-linking mass spectrometry approaches can identify interaction interfaces at amino acid resolution. When studying membrane-associated interactions, reconstitution of purified CNGA2 into nanodiscs or liposomes containing defined lipid compositions including PIP3 provides a controlled system to dissect lipid-protein interactions that regulate channel function .

How might advanced structural biology techniques enhance our understanding of CNGA2 regulation?

Advanced structural biology techniques offer transformative potential for understanding CNGA2 regulation at the molecular level. Cryo-electron microscopy (cryo-EM) could reveal the three-dimensional structure of full-length CNGA2 channels in different functional states (closed, open, desensitized) and in complex with regulatory molecules like PIP3 and Ca2+/CaM. Such structures would provide direct visualization of how the N-terminal regulatory domain (residues 61-90) interacts with the C-terminus in functioning channels and how PIP3 binding disrupts this interaction . X-ray crystallography of isolated domains, particularly the N-terminal region containing the overlapping binding sites for PIP3 and Ca2+/CaM, could reveal the structural basis for competitive regulation. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could map conformational changes upon ligand binding with peptide-level resolution. Molecular dynamics simulations based on these structures would further elucidate the dynamic aspects of channel regulation, potentially revealing allosteric communication pathways between binding sites and the channel gate. Single-molecule FRET studies could capture real-time conformational changes during channel activation and modulation. These approaches would collectively provide unprecedented insights into the molecular mechanisms underlying the intricate regulation of CNGA2 channels by multiple signaling pathways .

What emerging genetic technologies could advance CNGA2 functional studies in vivo?

Emerging genetic technologies offer exciting opportunities to study CNGA2 function with unprecedented precision in vivo. CRISPR-based approaches beyond simple knockouts include: (1) Base editing or prime editing to introduce specific point mutations that alter key functional residues without disrupting the entire protein; (2) Knock-in strategies to generate endogenously tagged CNGA2 for visualization and purification without overexpression artifacts; and (3) Conditional knockout systems using Cre-lox technology to delete CNGA2 in specific cell types or developmental stages . Optogenetic and chemogenetic tools could be combined with CNGA2 manipulations to precisely control neuronal activity while monitoring the impact of channel variants. Single-cell multi-omics approaches could reveal cell-type-specific functions of CNGA2 by correlating genetic manipulation with transcriptomic, proteomic, and functional readouts. Viral-based CRISPR libraries could enable high-throughput screening of CNGA2 variants in vivo. For spatial and temporal control, techniques such as light-inducible transcriptional systems could allow precise regulation of CNGA2 expression. These advanced genetic tools would facilitate dissection of CNGA2 functions in complex neural circuits and behaviors, potentially revealing previously unrecognized roles beyond traditional olfactory signal transduction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.