Recombinant Mouse Cysteine-rich and transmembrane domain-containing protein 1 (Cystm1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request as much as possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag for your order.
Synonyms
Cystm1; Cysteine-rich and transmembrane domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cystm1
Target Protein Sequence
MNPENPPPYPGPGPTAPYPPYPQQPMGPMGPMGAPPPQGYPYPPPQGYPYQGYPQYGWQG GPQEPPKTTVYVVEDQRRDDLGPSTCLTACWTALCCCCLWDMLT
Uniprot No.

Target Background

Database Links

UniGene: Mm.272527

Protein Families
CYSTM1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Cystm1 and to which protein family does it belong?

Cystm1 (Cysteine-rich and transmembrane domain-containing protein 1) belongs to the CYSTM family, a group of small molecular proteins found in tail-anchored membrane proteins across eukaryotes. This family is characterized as novel non-secreted cysteine-rich peptides (NCRPs) based on their conserved domain and small molecular weight. CYSTM proteins play vital roles in diverse developmental processes, with particularly significant functions in stress responses .

Recent research has suggested that the traditional designation of these proteins as transmembrane may require revision, as evidence indicates some CYSTM proteins bind to membranes via palmitoylation rather than functioning as true transmembrane proteins . Some researchers have proposed renaming this domain to CYSPD (Cysteine-rich Palmitoylated Domain) to better reflect their molecular characteristics .

What are the structural characteristics of Cystm1?

Cystm1 is characterized by:

  • Small molecular weight typical of the CYSTM family

  • Cysteine-rich regions that are highly conserved

  • C-terminal domain that facilitates protein-protein interactions, particularly dimerization with itself or other CYSTM family members

  • Membrane association that may be mediated through palmitoylation rather than a true transmembrane domain

The protein contains cysteine residues at the cytosolic border of what was previously considered a transmembrane domain, which are potential sites for palmitoylation that anchor the protein to membranes . Bioinformatic analysis using transmembrane prediction algorithms has yielded inconsistent results regarding the presence of a true transmembrane domain in CYSTM proteins .

What is the subcellular localization of Cystm1?

CYSTM family proteins display complex subcellular localization patterns. Most CYSTM proteins, including Cystm1, are detected at the plasma membrane and in the cytoplasm . Unlike typical transmembrane proteins of the secretory pathway, overexpressed CYSTM proteins generally do not show vacuolar staining .

In yeast studies of CYSTM proteins (Cpp1), when proteasome inhibitors were added, the protein relocated from the plasma membrane to intracellular dots, suggesting dynamic regulation of its localization . This behavior is consistent with the non-transmembrane nature of the CYSPD domain, as true transmembrane proteins of the plasma membrane are typically degraded in the vacuole rather than by the proteasome .

What functional roles has Cystm1 been associated with?

The CYSTM family, including Cystm1, has been implicated in:

  • Stress response mechanisms, particularly resistance to abiotic stress

  • Membrane-associated signaling processes

  • Protein-protein interactions through dimerization capabilities

  • Potential roles in disease processes, though specific mechanisms require further investigation

Studies in Arabidopsis have demonstrated that CYSTM members dramatically respond to various abiotic stresses, with analysis of overexpression lines revealing regulatory functions in stress responses .

What expression systems are most effective for producing recombinant mouse Cystm1?

When producing recombinant mouse Cystm1, consider the following expression systems based on research with similar cysteine-rich proteins:

  • Bacterial expression systems: While E. coli systems are cost-effective, they may present challenges for proper folding of cysteine-rich proteins. Consider using specialized strains with enhanced disulfide bond formation capabilities (e.g., Origami, SHuffle).

  • Mammalian expression systems: These provide the most natural post-translational modifications, especially important if palmitoylation is critical for function. HEK293 or CHO cells are recommended for mouse Cystm1 expression.

  • Insect cell systems: Baculovirus expression systems offer a compromise between proper eukaryotic processing and higher yields than mammalian systems.

For proper expression, design constructs that account for the potential membrane association through palmitoylation, as recent evidence suggests CYSTM proteins may not be true transmembrane proteins but rather associate with membranes through palmitoylation .

What purification strategies optimize yield and activity of recombinant Cystm1?

For effective purification of recombinant mouse Cystm1:

  • Affinity tags selection: His-tags or FLAG-tags positioned at the N-terminus are preferable to avoid interfering with C-terminal membrane association.

  • Detergent selection: If membrane-associated, mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are recommended for extraction while maintaining protein conformation.

  • Reducing agents: Include reducing agents (DTT or β-mercaptoethanol) in all buffers to prevent non-native disulfide bond formation between the cysteine-rich regions.

  • Purification protocol:

    • Start with affinity chromatography based on your chosen tag

    • Follow with size exclusion chromatography to separate monomers, dimers, and higher-order oligomers

    • Consider ion exchange chromatography as a polishing step if needed

Remember that if Cystm1 associates with membranes through palmitoylation rather than as a transmembrane protein , this will significantly impact extraction and purification approaches.

How can I design effective linkers for tandem Cystm1 constructs?

When designing tandem Cystm1 constructs for enhanced immunogenicity or functional studies, linker selection is critical:

  • Optimal linker characteristics:

    • Flexible glycine-serine linkers (e.g., "GGGGSGGG") have been shown to be effective for similar proteins, allowing proper folding while minimizing interference with structure and function

    • Length should allow independent folding of each domain (typically 5-15 amino acids)

    • Hydrophilic composition to ensure solubility

  • Validation approach:

    • Use bioinformatics to predict the impact of different linker sequences on protein structure

    • Verify that linkers don't disrupt T/B cell epitopes if immunogenicity is important

    • Test multiple linker designs experimentally to identify optimal configuration

  • Experimental verification:

    • Confirm correct expression and folding using circular dichroism

    • Verify biological activity through functional assays

    • Assess oligomerization state using size exclusion chromatography

Research with similar recombinant proteins has demonstrated that appropriate linker selection can significantly enhance protein stability and functional properties while increasing molecular weight and antigenic epitope presentation .

What are the most reliable methods to detect Cystm1 palmitoylation?

Based on recent research suggesting CYSTM proteins may be palmitoylated rather than true transmembrane proteins , the following methods are recommended to detect and study Cystm1 palmitoylation:

  • Metabolic labeling with azido-palmitate:

    • Incubate cells expressing Cystm1 with azido-palmitate

    • Perform click chemistry to biotinylate palmitoylated proteins

    • Pull down biotinylated proteins with streptavidin

    • Detect Cystm1 by Western blot

  • Acyl-biotin exchange (ABE) assay:

    • Block free thiols with N-ethylmaleimide

    • Cleave thioester bonds with hydroxylamine

    • Label newly exposed thiols with biotin-HPDP

    • Pull down biotinylated proteins and detect by Western blot

  • Site-directed mutagenesis:

    • Identify potential palmitoylation sites (typically cysteines near the C-terminus)

    • Create cysteine-to-alanine mutants

    • Compare localization and function of wild-type versus mutant proteins

  • Mass spectrometry:

    • Analyze purified Cystm1 by mass spectrometry to identify palmitoylated residues

    • Compare spectra before and after hydroxylamine treatment

These techniques have been successfully employed to demonstrate palmitoylation of CYSTM proteins in yeast and can be adapted for mouse Cystm1.

How can I effectively study Cystm1 protein-protein interactions?

To investigate Cystm1 protein-protein interactions:

  • Yeast two-hybrid screening:

    • Use Cystm1 as bait to identify interacting proteins

    • Confirm interactions using targeted Y2H assays

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Cystm1 antibodies or tag-specific antibodies for precipitating protein complexes

    • Identify interacting partners by mass spectrometry or Western blotting

    • Include appropriate controls to rule out non-specific binding

  • Proximity labeling techniques:

    • BioID: Express Cystm1 fused to a promiscuous biotin ligase (BirA*)

    • APEX2: Express Cystm1 fused to engineered ascorbate peroxidase

    • These approaches label proteins in close proximity to Cystm1 in living cells

  • Fluorescence techniques:

    • FRET (Förster Resonance Energy Transfer) to study direct interactions

    • BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in cells

Research has shown that CYSTM family members can dimerize with themselves or other family members through their C-terminal domain , making these techniques particularly relevant for studying Cystm1 interactions.

What are effective approaches to study Cystm1 function in stress response?

Given the established role of CYSTM proteins in stress response , the following approaches are recommended to study Cystm1's function in this context:

  • Gene manipulation strategies:

    • CRISPR/Cas9-mediated knockout or knockdown of Cystm1

    • Overexpression using lentiviral activation systems

    • Generation of conditional knockout mouse models

  • Stress induction protocols:

    • Oxidative stress: H₂O₂, paraquat exposure

    • ER stress: tunicamycin, thapsigargin treatment

    • Heat shock, osmotic stress, nutrient deprivation

  • Readouts to assess response:

    • Cell viability/death assays

    • Measurement of reactive oxygen species

    • Analysis of stress-responsive gene expression

    • Assessment of cellular damage markers

  • Time-course experiments:

    • Monitor Cystm1 expression changes during stress response

    • Correlate with cellular phenotypes and downstream signaling events

Research in plants has demonstrated that CYSTM family members are dramatically regulated in response to various abiotic stresses, with overexpression lines showing altered stress response phenotypes . Similar approaches can be applied to study mouse Cystm1.

How can I resolve conflicting data regarding Cystm1's membrane topology?

Recent research has challenged the traditional classification of CYSTM proteins as transmembrane, suggesting they may instead associate with membranes via palmitoylation . To resolve conflicting data regarding Cystm1's membrane topology:

  • Transmembrane domain verification:

    • Apply multiple prediction algorithms and compare results

    • Note that for similar CYSTM proteins, only four out of nine transmembrane prediction software tools suggested a transmembrane domain

  • Membrane insertion machinery dependence:

    • Test localization in cells deficient in GET complex components (required for tail-anchored protein insertion)

    • Examine dependence on EMC complex (involved in low-hydrophobicity tail-anchored protein insertion)

    • For reference, CYSTM proteins in yeast were unaffected by GET1 or EMC3/6 deletion, unlike known tail-anchored proteins

  • Biochemical approaches:

    • Carbonate extraction to distinguish peripheral from integral membrane proteins

    • Protease protection assays to determine topology

    • Detergent partitioning experiments

  • Structural studies:

    • Cryo-EM or X-ray crystallography of purified protein

    • NMR studies of CYSTM domain in membrane mimetics

Integrating multiple lines of evidence will help resolve the true nature of Cystm1's membrane association and contribute to the ongoing reassessment of CYSTM proteins as potentially palmitoylated peripheral membrane proteins rather than transmembrane proteins .

What is the relationship between Cystm1 and cellular stress pathways in disease models?

To investigate Cystm1's role in stress pathways within disease contexts:

  • Disease-relevant stress models:

    • Myocardial infarction models (given potential relationships with conserved genes in MI)

    • Inflammatory stress conditions

    • Metabolic stress scenarios

  • Signaling pathway integration:

    • Examine Cystm1 interaction with known stress response mediators:

      • MAP kinase pathways

      • NF-κB signaling

      • Unfolded protein response components

    • Phosphoproteomic analysis following stress induction

  • Temporal dynamics:

    • Analyze acute versus chronic effects of Cystm1 modulation

    • Study compensatory mechanisms in long-term Cystm1 deficiency

  • Therapeutic potential assessment:

    • Evaluate whether Cystm1 modulation affects disease outcomes

    • Test whether targeting Cystm1 enhances or mitigates stress-induced damage

Since some CYSTM family members have been associated with ubiquitin ligases like Rsp5 in yeast , investigating similar interactions in mouse models could provide insights into Cystm1's role in protein quality control during stress responses.

How do post-translational modifications regulate Cystm1 function?

Beyond palmitoylation, understanding the full spectrum of post-translational modifications (PTMs) affecting Cystm1 is critical:

  • PTM identification strategies:

    • Mass spectrometry-based proteomic analysis of purified Cystm1

    • Phospho-specific antibodies to detect phosphorylation events

    • Investigation of ubiquitination status using ubiquitin pulldowns

  • Dynamic regulation:

    • Temporal changes in PTMs during stress response

    • Cell cycle-dependent modifications

    • Tissue-specific modification patterns

  • Functional consequences:

    • Site-directed mutagenesis of modified residues

    • Analysis of how modifications affect:

      • Subcellular localization

      • Protein-protein interactions

      • Protein stability and turnover

      • Stress response function

  • Regulatory enzymes:

    • Identify kinases, phosphatases, and palmitoyl transferases that modify Cystm1

    • Investigate E3 ubiquitin ligases (in yeast, CYSTM proteins interact with the E3 ligase Rsp5)

Understanding these regulatory mechanisms will provide deeper insights into how Cystm1 function is modulated in different cellular contexts and stress conditions.

What are the best approaches to generate and validate Cystm1 antibodies?

Generating specific antibodies against Cystm1:

  • Antigen design strategies:

    • Full-length recombinant protein may present challenges due to membrane association

    • Consider unique peptide regions outside the CYSTM domain for greater specificity

    • Use bioinformatics to identify antigenic regions with low homology to other family members

  • Validation requirements:

    • Western blot of tissues with known Cystm1 expression compared to knockout controls

    • Immunoprecipitation followed by mass spectrometry confirmation

    • Immunofluorescence patterns consistent with expected localization

    • Loss of signal in Cystm1 knockout or knockdown samples

  • Cross-reactivity testing:

    • Test against other CYSTM family members

    • Evaluate specificity across species if conducting comparative studies

  • Application-specific validation:

    • Validate separately for each application (Western blot, IP, IF, IHC)

    • Determine optimal conditions for each technique

Given the high sequence conservation within the CYSTM family, rigorous validation is essential to ensure antibody specificity to Cystm1 rather than other family members.

How should I design CRISPR/Cas9 strategies for Cystm1 gene manipulation?

For effective CRISPR/Cas9-based manipulation of Cystm1:

  • Guide RNA design considerations:

    • Target early exons to ensure complete functional disruption

    • Avoid regions with homology to other CYSTM family members

    • Use multiple prediction algorithms to select guides with high on-target and low off-target scores

    • Consider chromatin accessibility at target sites

  • Experimental approaches:

    • Knockout generation: Design paired gRNAs to delete critical exons

    • Knockin strategies: Include homology arms of ≥500bp for efficient integration

    • Activation systems: Consider CRISPR activation approaches using deactivated Cas9 (dCas9) fused to activation domains like VP64

  • Validation strategies:

    • Genomic verification by PCR and sequencing

    • Transcript analysis by RT-PCR and sequencing

    • Protein-level confirmation by Western blot

    • Functional validation through phenotypic assays

  • Cell-type specific considerations:

    • Adjust delivery methods based on target cell type transfection efficiency

    • Consider conditional approaches if complete knockout is embryonic lethal

CRISPR activation systems using deactivated Cas9 fused to VP64 activation domains have been developed for CYSTM1 and can be adapted for mouse Cystm1 studies .

What controls are essential when studying Cystm1 localization and trafficking?

When investigating Cystm1 localization and trafficking:

  • Essential controls for localization studies:

    • Include known subcellular markers (e.g., plasma membrane, endoplasmic reticulum, Golgi, endosomes)

    • Use palmitoylation inhibitors to confirm dependency of localization on this modification

    • Include palmitoylation-deficient mutants (cysteine to alanine)

    • Validate with multiple approaches (fractionation and microscopy)

  • Trafficking pathway investigation:

    • Employ endocytosis inhibitors to assess internalization requirements

    • Use recycling pathway mutants to evaluate return to plasma membrane

    • For reference, in yeast studies, CYSTM protein GFP-Cpp1 showed polarized distribution that was lost in endocytosis-deficient strains (sla1Δ) and accumulated internally in recycling-deficient strains (ric1Δ)

  • Dynamic studies:

    • Photoactivatable or photoconvertible fusion proteins to track movement

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

    • Live-cell imaging with appropriate temporal resolution

  • Degradation pathway assessment:

    • Proteasome inhibitors (e.g., MG132) to assess proteasomal degradation

    • Lysosomal inhibitors to examine vacuolar/lysosomal degradation

    • Note that in yeast, CYSTM protein degradation was prevented by the proteasome inhibitor MG132, consistent with non-transmembrane proteins

These controls will help distinguish the true localization patterns of Cystm1 and resolve questions about its membrane association mechanism.

How might the reclassification of CYSTM to CYSPD impact research approaches?

The proposed reclassification of the CYSTM domain to CYSPD (Cysteine-rich Palmitoylated Domain) based on recent findings has significant implications:

  • Experimental design reconsideration:

    • Shift focus from transmembrane topology studies to palmitoylation dynamics

    • Reevaluate membrane association studies with emphasis on peripheral association

    • Revise protein purification strategies to account for lipid modifications

  • Functional reassessment:

    • Investigate roles in lipid rafts and membrane microdomains

    • Explore potential reversibility of membrane association through depalmitoylation

    • Examine interactions with other palmitoylated proteins

  • Evolutionary perspective:

    • Compare CYSPD domains across species for conservation of palmitoylation sites

    • Analyze potential convergent evolution with other palmitoylated protein families

    • Trace evolutionary relationships between true transmembrane and palmitoylated CYSTM/CYSPD proteins

  • Nomenclature and database implications:

    • Update structural classification in protein databases

    • Revise search terms and annotations for literature mining

    • Establish clear criteria for family membership

This paradigm shift requires researchers to reevaluate previous assumptions about Cystm1 function and adopt new experimental approaches focused on dynamic palmitoylation rather than static transmembrane topology.

What emerging technologies will advance Cystm1 research?

Several cutting-edge technologies show promise for advancing Cystm1 research:

  • Spatially-resolved transcriptomics and proteomics:

    • Single-cell approaches to map Cystm1 expression in heterogeneous tissues

    • Spatial proteomics to define precise subcellular localization

    • Proximity labeling combined with mass spectrometry for interaction mapping

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize nanoscale membrane association

    • Correlative light and electron microscopy (CLEM) for ultrastructural context

    • Lattice light-sheet microscopy for long-term live-cell imaging with minimal phototoxicity

  • Protein structure determination:

    • Cryo-EM advances for membrane-associated proteins

    • AlphaFold and other AI-based structure prediction tools

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Genetic engineering advances:

    • Base editing and prime editing for precise genetic modifications

    • Inducible CRISPR systems for temporal control of gene expression

    • Tissue-specific gene manipulation using AAV-delivered CRISPR systems

These technologies will enable more precise characterization of Cystm1's structure, interactions, and functions in various physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.