Recombinant Mouse Cysteine-rich with EGF-like domain protein 1 (Creld1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please specify it for prioritized development.
The specific tag type is determined during production. If a particular tag is required, please specify it for prioritized development.
Synonyms
Creld1; Protein disulfide isomerase Creld1; Cysteine-rich with EGF-like domain protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-420
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Creld1
Target Protein Sequence
QPSPPPHPSPRAEPHPCHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETR
LVEVLEGVCSRSDFECHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFG
PSCLPCPGGTERPCGGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHL
VCSACFGPCARCTGPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSY
ECRDCAKACLGCMGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYR
CVCAEGYRQEDGICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVF
TAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Uniprot No.
Target Background
Function
Protein disulfide isomerase; facilitates the targeting of acetylcholine receptors (AChRs) to the plasma membrane.
Gene References Into Functions
- Murine Creld1 regulates cardiac development via activation of calcineurin/NFATc1 signaling. PMID: 24697899
Database Links
Protein Families
CRELD family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in myoblast C2C12 cells (at protein level).
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
