Recombinant Mouse Cysteinyl leukotriene receptor 2 (Cysltr2)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling Pathways

Cysltr2 regulates immune and vascular responses through interactions with cysteinyl leukotrienes (CysLTs: LTC₄, LTD₄, LTE₄). Key findings include:

Immune Regulation

  • Negative Feedback on Cysltr1: Genetic deletion of Cysltr2 in mice enhances Cysltr1-mediated ERK phosphorylation and Th2-driven pulmonary inflammation, suggesting cross-regulation between receptors .

  • Dendritic Cell Modulation: Cysltr2⁻/⁻ dendritic cells exhibit elevated allergen sensitization capacity, linked to increased Cysltr1 surface expression .

Vascular and Tumor Biology

  • Endothelial Permeability: Cysltr2 activation promotes vascular leakage via Rho/ROCK-dependent myosin light chain phosphorylation .

  • Tumor Growth: Cysltr2⁻/⁻ mice show reduced tumor angiogenesis and metastasis in Lewis lung carcinoma models, highlighting its role in vascular dysregulation .

Recombinant Cysltr2 Reagents

Available reagents for research include:

Proteins

CodeSourcePurityApplications
RFL30584MF E. coli>90%SDS-PAGE, binding assays
CSB-CF006466MO E. coli>95%Functional studies

Antibodies

CodeReactivityApplications
CSB-PA040037 MouseWB, IF, ELISA

Mechanistic Insights

  • Receptor Crosstalk: Cysltr2 forms heteromeric complexes with Cysltr1, reducing Cysltr1 surface expression and signaling efficacy .

  • Ligand Selectivity: BAY u9773 (partial agonist) induces pulmonary vein contraction, while LTD₄ preferentially activates Cysltr1 .

Pathway Involvement

PathwayAssociated Proteins
Calcium signaling CAMK2D1, CALM3, NOS1
Neuroactive ligand-receptor CHRNB3, VIPR1, LPAR2

Applications in Research

  • Drug Development: Structural studies (e.g., X-ray crystallography) have identified ligand-binding pockets for designing dual Cysltr1/Cysltr2 antagonists .

  • Disease Models: Used to study asthma, cancer metastasis, and vascular disorders .

Critical Considerations

  • Species-Specificity: Mouse Cysltr2 shares 78% amino acid identity with human CYSLTR2, necessitating cautious extrapolation of findings .

  • Expression Artifacts: Recombinant proteins lack native post-translational modifications, potentially altering ligand-binding kinetics .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cysltr2; Cyslt2; Cysteinyl leukotriene receptor 2; CysLTR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEVTGTPSSYSNRNCTIENFKKEFYPIIYLIIFFWGALGNGFSIYVFLQTCKKSTSVNVF MLNLATSDFLFISTLPFRADYYFRGSNWIFGDLACRVMSYSLYVNMYTSIYFLTVLSVVR FLATVHPFRMFHVTSVRSAWILCGIIWVFIMASSALLLVNGQEEKDNIISCLELSPQKFK SLLIMNHIAVAVGFLLPFLTLTVCYLLIIRILLKAEIPESGPRAAHRKALTTIVIAMITF LLCFLPYHALRTLHLVTWDKDSCGDVLHKATVITLTMAAANSCFNPFLYYFAGENFKARL RAIFSKVHL
Uniprot No.

Target Background

Function
Cysteinyl leukotriene receptor 2 (CysLT2R) is a receptor for cysteinyl leukotrienes. Its activation is mediated by a G-protein that triggers a phosphatidylinositol-calcium second messenger system. The affinity order for leukotrienes is LTC4 = LTD4 >> LTE4.
Gene References Into Functions
  1. CysLT2R signaling, IL-33-dependent group 2 innate lymphoid cell expansion, and IL-33-driven mast cell activation are essential for the induction of type 2 immunopathology and aspirin sensitivity. CysLT2R-targeted drugs may interrupt these processes. PMID: 29282304
  2. CysLT2R plays a critical role in Ab1e42-induced neurotoxicity. PMID: 24269024
  3. The CysLT(1) and CysLT(2) receptors are primarily localized in neurons, microglia, and neutrophils. PMID: 23132680
  4. Research suggests that endothelial and nonendothelial CysLT2R niches have distinct roles in mediating inflammatory responses in ischemic/perfusion injury. PMID: 24285579
  5. LTC4 activates mouse platelets exclusively through CysLT2R. LTC4/CysLT2R signaling necessitates an autocrine ADP-mediated response through P2Y12 receptors. PMID: 24244016
  6. CysLT1R, CysLT2R, and GPR17 may be involved in the MPTP-induced Parkinson disease damage in mice. PMID: 23505108
  7. CysLT2R negatively regulates the development of cys-LT-dependent T helper cell (Th)2 pulmonary inflammation by inhibiting both CysLT1R signaling and house dust mite-induced LTC4S-dependent cell surface expression of CysLT1R on dendritic cells. PMID: 23002438
  8. Studies indicate a role for eosinophil-derived cysteinyl leukotriene and the CysLT(2)R in the hyperkeratosis and fibrosis of allergic skin inflammation. PMID: 22416124
  9. Findings implicate the CysLT(2)R in the progression of ischemic retinopathy. PMID: 22131271
  10. Research suggests that a lack of neuronal expression of CysLTR in the murine colonic myenteric plexus attenuates colitis disease progression. PMID: 21641390
  11. Findings show that CysLT1 receptor attenuates while CysLT2 receptor facilitates oxygen glucose deprivation -induced PC12 cell death. PMID: 16756959
  12. CysLT2 receptors interact with CysLT1 receptors and down-modulate cysteinyl leukotriene dependent mitogenic responses of mast cells. PMID: 17693579
  13. Endothelium-targeted overexpression of CysLT2R aggravates myocardial ischemia-reperfusion injury by increasing endothelial permeability, accelerating left ventricular remodeling, and impairing cardiac performance. PMID: 18276782

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed at low levels, with highest expression in the spleen, thymus and adrenal gland, and lower in the kidney, brain and peripheral blood leukocytes.

Q&A

What is the molecular structure of mouse Cysteinyl leukotriene receptor 2?

Mouse Cysteinyl leukotriene receptor 2 (Cysltr2) is encoded by a cDNA that produces a protein of 309 amino acids, which is truncated at both N-terminal and C-terminal ends compared to its human ortholog. The gene is located on the central region of mouse chromosome 14 and consists of 6 exons with the entire coding sequence contained within the last exon. Two 5'-untranslated region splice variants have been identified, with the short form (lacking exon 3) being the predominant transcript in mouse tissues .

How does mouse Cysltr2 differ from human CysLT2R?

The mouse Cysltr2 protein is structurally shorter than its human counterpart at both terminal ends. More significantly, there are substantial differences in expression patterns between species. In mice, Cysltr2 is expressed in approximately 10% of dorsal root ganglion (DRG) neurons, primarily in a specific subset called NP3 neurons. In contrast, human CYSLTR2 shows much broader expression, being detected in approximately 63% of human DRG neurons. This wider distribution suggests potentially expanded functional roles in humans compared to mice .

Which ligands activate mouse Cysltr2 and with what potency?

Recombinant mouse Cysltr2, when expressed in human embryonic kidney (HEK293T) cells, responds to cysteinyl leukotrienes with a distinct rank order of potency: leukotriene C4 (LTC4) = leukotriene D4 (LTD4) >> leukotriene E4 (LTE4). This has been demonstrated through calcium mobilization assays, where intracellular calcium flux was measured following stimulation with these ligands. In radioligand binding studies, [3H]LTD4 binding to membranes expressing mouse Cysltr2 can be effectively competed by LTC4 and LTD4, and only partially inhibited by LTE4 and the dual receptor antagonist BAYu9773 .

What are the recommended methods for generating recombinant mouse Cysltr2 for in vitro studies?

For in vitro characterization of mouse Cysltr2, transfection of the receptor into human embryonic kidney (HEK293T) cells has proven effective. The full-length coding sequence should be cloned into an appropriate mammalian expression vector with a strong promoter. Transfection efficiency can be optimized using lipid-based reagents or electroporation depending on the cell line. For functional assays, stable cell lines expressing mouse Cysltr2 are preferable to minimize variability.

For receptor binding assays, membrane preparations from transfected cells should be used with [3H]LTD4 as the radioligand. Competition binding can be performed with unlabeled ligands including LTC4, LTD4, LTE4, and receptor antagonists such as BAYu9773. Functional responses can be assessed through calcium mobilization assays using fluorescent calcium indicators like Fura-2 or calcium-sensitive dyes .

How can researchers effectively generate and validate Cysltr2 knockout mice?

Generation of Cysltr2 knockout mice (Cysltr2-/-) requires targeted disruption of the Cysltr2 gene. This can be achieved through conventional homologous recombination in embryonic stem cells or more efficiently using CRISPR-Cas9 genome editing. Since the entire coding region of Cysltr2 is contained within a single exon, targeting this exon for deletion or disruption is an effective strategy.

Validation of knockout should include:

  • Genotyping using PCR to confirm gene disruption

  • mRNA expression analysis using qPCR or ribonuclease protection assay to verify absence of transcript

  • Functional validation using calcium mobilization assays in tissues known to express Cysltr2

  • Phenotypic assessment in models where Cysltr2 has established roles, such as itch responses to LTC4 injection or decreased scratching in MC903-induced dermatitis models at day 12

Research has demonstrated that Cysltr2-/- mice show normal development but exhibit specific phenotypic differences in inflammatory models, particularly decreased scratching behavior in chronic phases of MC903-induced dermatitis and reduced skin fibrosis in ovalbumin sensitization models .

What experimental design is optimal for studying Cysltr2-mediated itch responses in mice?

To study Cysltr2-mediated itch in mice, researchers should consider the following experimental design:

  • Animal selection: Use adult mice (8-12 weeks), including Cysltr2-/- mice and appropriate wild-type controls on the same genetic background. Both male and female mice should be tested as biological replicates.

  • Acute itch induction: Inject 10-100 ng of purified leukotriene C4 (LTC4) intradermally into the cheek or nape of the neck. The cheek model allows differentiation between itch (face-wiping) and pain (face-scratching) behaviors.

  • Behavior recording: Video record behaviors for at least 30 minutes following injection, as LTC4-induced scratching has a specific temporal profile that differs from other pruritogens.

  • Quantitative analysis: Analyze scratching bouts, distinguishing between short bouts (<0.3 seconds) and long bouts (>1 second). LTC4 characteristically induces longer scratching bouts compared to other pruritogens like histamine or chloroquine.

  • Controls: Include histamine (50 μg), chloroquine (200 μg), and compound 48/80 (100 μg) as comparative pruritogens with distinct mechanisms. Vehicle controls are essential .

How can researchers distinguish between CysLT1R and CysLT2R-mediated effects in experimental models?

Distinguishing between CysLT1R and CysLT2R-mediated effects requires a multi-faceted approach:

  • Genetic models: Compare phenotypes in Cysltr1-/- and Cysltr2-/- mice in parallel experiments. This approach provides the most definitive evidence for receptor specificity, as demonstrated in skin inflammation models where only Cysltr2-/- mice showed protection against thickening and collagen deposition.

  • Selective pharmacological tools: Use receptor-selective antagonists:

    • Montelukast: Selectively blocks CysLT1R without affecting CysLT2R

    • BAYu9773: Dual antagonist that blocks both CysLT1R and CysLT2R

  • Ligand selectivity: Exploit differential responses to cysteinyl leukotrienes:

    • LTC4: Equal potency at both receptors but induces distinct functional responses via CysLT2R

    • LTD4: Preferentially activates CysLT1R in many systems

    • LTE4: Less potent at both receptors but may have unique signaling properties

  • Response characteristics: Monitor endpoint-specific responses; for example, in skin inflammation models, CysLT2R specifically mediates fibrosis and epidermal thickening, while immune cell infiltration occurs independently of either receptor .

What is the role of Cysltr2 in allergic skin inflammation models?

In allergic skin inflammation models, Cysltr2 plays critical roles in tissue remodeling and pruritus, particularly in later phases of inflammation. In ovalbumin epicutaneous sensitization models, Cysltr2-deficient mice show significantly reduced skin thickening and collagen deposition compared to wild-type mice, despite normal immune cell infiltration.

This indicates that Cysltr2 specifically mediates the fibrotic response in allergic skin inflammation. The mechanism involves direct action of leukotriene C4 on skin fibroblasts via Cysltr2, stimulating collagen synthesis. Additionally, leukotriene C4 signaling through Cysltr2 on fibroblasts induces production of keratinocyte growth factors (including IL-6 and GM-CSF), which indirectly promotes keratinocyte proliferation and epidermal thickening .

In MC903-induced chronic dermatitis models, Cysltr2-deficient mice show decreased scratching behaviors specifically during the chronic phase (day 12), without significant differences in early inflammation, suggesting a time-dependent role in pruritus development .

How does Cysltr2 contribute to neuronal mechanisms of itch?

Cysltr2 is specifically enriched in a subset of dorsal root ganglion (DRG) sensory neurons called NP3 neurons, which are known to be important for pruriception (itch sensing). In acute models, intradermal injection of leukotriene C4 induces immediate scratching behaviors in mice that are entirely dependent on Cysltr2 expression.

The quality of Cysltr2-mediated itch has distinct characteristics:

  • LTC4 induces longer-duration scratching bouts (>1 second) compared to histamine or chloroquine

  • Unlike histamine, LTC4 does not induce alloknesis (touch-evoked itch)

  • The temporal profile of LTC4-induced scratching differs from other pruritogens

Using bone marrow chimera experiments, researchers have demonstrated that radioresistant cells (likely neurons) expressing Cysltr2 are necessary for LTC4-induced itch, while expression in hematopoietic cells is dispensable for this response. This suggests that direct activation of sensory neurons by LTC4 via Cysltr2 is the primary mechanism of acute pruritogenic effects .

What is known about the interaction between Cysltr2 and eosinophil-derived mediators in tissue remodeling?

Eosinophils are major producers of leukotriene C4 and play a critical role in tissue remodeling during allergic inflammation. Research has established a direct link between eosinophil-derived leukotriene C4 and Cysltr2-mediated tissue remodeling:

  • ΔdblGATA mice, which lack eosinophils, fail to develop skin thickening and collagen deposition in ovalbumin sensitization models.

  • Adoptive transfer of wild-type bone marrow-derived eosinophils, but not eosinophils from LTC4 synthase-deficient mice, restores skin thickening and collagen deposition in ΔdblGATA recipients.

  • Eosinophils express high levels of LTC4 synthase but not LTA4 hydrolase, making them specialized producers of cysteinyl leukotrienes rather than leukotriene B4.

  • In skin fibrosis models, eosinophil-derived LTC4 acts directly on skin fibroblasts via Cysltr2 to stimulate collagen production. These fibroblasts subsequently release growth factors that promote keratinocyte proliferation, establishing a pathway from eosinophil infiltration to both dermal and epidermal remodeling .

How can researchers overcome the challenge of low Cysltr2 expression levels in mouse tissues?

The relatively low expression levels of Cysltr2 in most mouse tissues present technical challenges for detection and functional studies. Researchers can employ several strategies to overcome this limitation:

  • Enhanced detection methods: Use highly sensitive techniques such as RNAscope in situ hybridization, which can detect low-abundance transcripts with cellular resolution. Quantitative PCR with pre-amplification steps can also improve detection sensitivity.

  • Targeted tissue selection: Focus on tissues with highest Cysltr2 expression (spleen, thymus, adrenal gland) for initial studies, or use enriched cell populations like the NP3 subset of DRG neurons.

  • Single-cell approaches: Single-cell RNA sequencing can identify specific cell populations expressing Cysltr2, even when bulk tissue expression appears low.

  • Reporter mice: Generate knock-in reporter mice expressing fluorescent proteins under the Cysltr2 promoter to facilitate visualization and isolation of Cysltr2-expressing cells.

  • Recombinant expression systems: For functional studies, use overexpression in heterologous systems like HEK293T cells, which has proven effective for characterizing receptor pharmacology .

What are the recommended methods for analyzing Cysltr2-mediated effects on collagen synthesis in skin fibroblasts?

To analyze Cysltr2-mediated effects on collagen synthesis in skin fibroblasts, researchers should consider the following methodology:

  • Primary cell isolation: Isolate primary skin fibroblasts from mouse or human skin using enzymatic digestion with collagenase and dispase, followed by selective adhesion culture.

  • Stimulation protocol: Stimulate fibroblasts with purified leukotriene C4 at concentrations of 10-100 nM for 24 hours in serum-free medium. Include appropriate controls:

    • Unstimulated cells

    • Cells treated with receptor antagonists (montelukast for CysLT1R, BAYu9773 for both receptors)

    • Positive control stimulants (TGF-β at 5 ng/ml)

  • Collagen quantification: Measure collagen production using:

    • Sircol collagen assay for soluble collagen in culture supernatants

    • Hydroxyproline assay for total collagen content

    • qPCR for COL1A1 and COL3A1 mRNA expression

    • Western blot for procollagen and processed collagen proteins

  • Receptor validation: Confirm Cysltr2 expression in the fibroblasts using qPCR and validate receptor function using calcium mobilization assays in response to LTC4 stimulation.

  • Secretome analysis: Collect conditioned medium from LTC4-stimulated fibroblasts to analyze secreted factors that may affect other cell types, such as keratinocytes. Measure cytokine production (particularly IL-6 and GM-CSF) by ELISA .

What experimental considerations are important when comparing Cysltr2 function across species?

When comparing Cysltr2 function across species, researchers must consider several important factors that impact experimental design and interpretation:

  • Expression pattern differences:

    • Mouse: Cysltr2 is expressed in ~10% of DRG neurons (primarily NP3 subset)

    • Human: CYSLTR2 is expressed in ~63% of DRG neurons (broader distribution)

    • Rat: Cysltr2 is expressed in ~36% of DRG neurons (mainly IB4+ neurons)

  • Functional specialization:

    • In mice, Cysltr2 primarily mediates itch responses

    • In rats, Cysltr2 may be involved in pain sensitization

    • In humans, the broader expression suggests potentially diverse roles

  • Co-receptor expression:

    • Species differences in co-expression with other receptors (P2rx3, TRPV1) may influence signaling outcomes

    • Mouse Cysltr2+ neurons co-express Nppb and IL-31ra

    • Rat Cysltr2+ neurons co-express P2rx3

  • Pharmacological variations:

    • Verify ligand potency and specificity for each species variant

    • Confirm antagonist effectiveness across species

    • Consider potential differences in downstream signaling pathways

  • Translational implications:

    • Use multiple species when possible for comparative studies

    • Exercise caution when extrapolating findings between species

    • Consider humanized mouse models for translational studies

How should researchers interpret behavioral differences between Cysltr2 knockout and wild-type mice in chronic itch models?

When interpreting behavioral differences between Cysltr2 knockout and wild-type mice in chronic itch models, researchers should consider the following analytical framework:

  • Temporal dynamics: Cysltr2-deficient mice show normal scratching in early phases of MC903-induced dermatitis but reduced scratching specifically at day 12. This suggests that different mediators control itch at different phases of chronic inflammation. Comprehensive time-course analysis is essential for accurately capturing the role of Cysltr2.

  • Bout analysis: Analyze not just the frequency but also the duration and pattern of scratching bouts. In Cysltr2-deficient mice, both short bouts (<0.3 seconds) and longer bouts show reductions at day 12, with a significant decrease specifically in long bouts (>1 second). This pattern differs from other pruritogen-receptor systems and provides insight into the quality of Cysltr2-mediated itch.

  • Dissociation from inflammation: Despite reduced scratching, Cysltr2-deficient mice show similar ear swelling and epidermal thickening compared to wild-type mice in MC903 models. This dissociation indicates that Cysltr2-mediated itch can occur independently of gross inflammatory markers, though specific immune cell populations (eosinophils and macrophages) are reduced.

  • Neuronal vs. immune cell contribution: Use bone marrow chimeras or conditional knockout approaches to distinguish between neuronal and immune cell contributions to the observed phenotype. Previous studies indicate that radioresistant cells (likely neurons) expressing Cysltr2 are necessary for itch responses .

What are the important considerations when analyzing Cysltr2-mediated calcium responses in transfected cell systems?

When analyzing Cysltr2-mediated calcium responses in transfected cell systems, researchers should consider several important technical and interpretive factors:

  • Expression level control:

    • Monitor receptor expression levels using qPCR or Western blotting

    • Normalize calcium responses to receptor expression levels

    • Consider using inducible expression systems for tight control

  • Signal detection optimization:

    • Use ratiometric calcium indicators (e.g., Fura-2) for quantitative measurements

    • Establish appropriate sampling rates (typically 1-5 Hz) to capture rapid calcium transients

    • Include positive controls for cell viability and calcium signaling (e.g., ATP, ionomycin)

  • Concentration-response relationships:

    • Test wide concentration ranges of ligands (typically 0.1 nM to 10 μM)

    • Calculate EC50 values for different ligands to establish rank order potency

    • For mouse Cysltr2, expect LTC4 = LTD4 >> LTE4 potency pattern

  • Receptor specificity controls:

    • Include cells expressing CysLT1R for comparison

    • Use receptor-selective antagonists (montelukast for CysLT1R, BAYu9773 for both receptors)

    • Include mock-transfected cells as negative controls

  • Desensitization analysis:

    • Monitor response kinetics and potential desensitization with repeated stimulations

    • Allow sufficient time between stimulations for receptor resensitization

    • Consider analyzing receptor internalization following stimulation

How can researchers reconcile contradictory findings between different experimental models of Cysltr2 function?

Reconciling contradictory findings between different experimental models of Cysltr2 function requires systematic analysis of methodological differences and biological complexities:

  • Model-specific differences:

    • Acute vs. chronic models: Cysltr2 may have different roles depending on the time course of inflammation

    • Tissue specificity: Skin, lung, and nervous system models may reveal distinct functions

    • Induction method: MC903, ovalbumin, and bleomycin models engage different upstream pathways

  • Cell type-specific effects:

    • Neuronal Cysltr2: Primarily mediates sensory functions like itch

    • Fibroblast Cysltr2: Drives collagen synthesis and tissue remodeling

    • Analyze cell-specific knockout models to dissect these distinct roles

  • Ligand levels and availability:

    • Measure tissue levels of cysteinyl leukotrienes in different models

    • Consider enzymatic conversion between LTC4, LTD4, and LTE4

    • Analyze expression of biosynthetic enzymes (LTC4 synthase) in relevant tissues

  • Species differences:

    • Mouse vs. human vs. rat models show significant differences in Cysltr2 expression patterns

    • Consider using humanized mice or complementary in vitro approaches with human cells

  • Genetic background effects:

    • BALB/c vs. C57BL/6 mice may show different inflammatory responses

    • Control for background strain in knockout studies

    • Consider congenic strains to isolate genetic contributions

What are the emerging therapeutic implications of targeting Cysltr2 in inflammatory skin diseases?

Research on Cysltr2 has revealed several promising therapeutic implications for inflammatory skin diseases:

  • Atopic dermatitis treatment: Cysltr2 antagonists may represent a novel therapeutic approach for atopic dermatitis, particularly for addressing chronic itch and tissue remodeling. Unlike CysLT1R antagonists (e.g., montelukast), which have shown limited efficacy in skin diseases, CysLT2R-specific inhibition targets the receptor proven to mediate skin fibrosis and contributes to chronic pruritus.

  • Dual-targeting approach: Combined inhibition of eosinophil recruitment and Cysltr2 signaling could provide synergistic benefits by addressing both the source of cysteinyl leukotrienes and their effector receptor.

  • Fibrosis reduction: Targeting Cysltr2 specifically inhibits collagen production by skin fibroblasts, potentially reducing scarring and fibrotic remodeling in chronic skin conditions. This effect appears independent of inflammatory cell recruitment.

  • Keratinocyte proliferation modulation: Through indirect effects on keratinocyte growth factor production by fibroblasts, Cysltr2 antagonism may normalize epidermal hyperplasia seen in conditions like atopic dermatitis.

  • Chronic itch management: The specific involvement of Cysltr2 in chronic phases of itch suggests a potential therapeutic window for targeting established, difficult-to-treat pruritus rather than acute itch sensations .

What are recommended approaches for developing Cysltr2-selective compounds for research applications?

Developing Cysltr2-selective compounds for research applications requires strategic approaches to achieve receptor selectivity:

  • Structure-activity relationship (SAR) studies:

    • Begin with modifications of known dual antagonists like BAYu9773

    • Focus on structural elements that interact with non-conserved regions between CysLT1R and CysLT2R

    • Use computational modeling based on receptor homology models to guide design

  • High-throughput screening platforms:

    • Develop cell-based assays using recombinant mouse and human Cysltr2

    • Implement calcium mobilization or receptor internalization assays

    • Include counterscreens against CysLT1R to identify selective compounds

  • Validation pipeline:

    • Confirm binding affinity using radioligand displacement assays

    • Verify functional antagonism in calcium signaling assays

    • Test efficacy in primary cells (fibroblasts) for inhibition of collagen synthesis

    • Evaluate in vivo efficacy in established models (LTC4-induced acute itch, chronic dermatitis)

  • Physiochemical optimization:

    • Ensure compounds have appropriate properties for in vivo testing

    • Optimize membrane permeability for accessing intracellular binding sites

    • Consider topical formulations for skin disease applications

  • Tools beyond small molecules:

    • Develop function-blocking antibodies against extracellular domains

    • Consider antisense oligonucleotides or siRNA approaches for research applications

    • Design genetic tools like dominant negative constructs

How might single-cell transcriptomics advance our understanding of Cysltr2 function in complex tissues?

Single-cell transcriptomics offers transformative potential for understanding Cysltr2 function in complex tissues:

  • High-resolution cellular mapping:

    • Precise identification of all Cysltr2-expressing cell types beyond known populations

    • Quantification of expression levels at single-cell resolution

    • Discovery of previously unrecognized Cysltr2-expressing populations

  • Co-expression networks:

    • Identification of receptors, signaling molecules, and transcription factors co-expressed with Cysltr2

    • Mapping of complete signaling pathways associated with Cysltr2 in different cell types

    • Discovery of potential co-regulatory factors that modify Cysltr2 function

  • Temporal dynamics during inflammation:

    • Analysis of expression changes during disease progression

    • Identification of triggers for Cysltr2 upregulation or downregulation

    • Correlation with disease phenotypes and treatment responses

  • Species comparative analysis:

    • Direct comparison of mouse, rat, and human Cysltr2-expressing cells

    • Identification of conserved and divergent expression patterns

    • Better translation between animal models and human disease

  • Therapeutic target validation:

    • Precision targeting of specific Cysltr2-expressing cell populations

    • Prediction of on-target and off-target effects based on comprehensive expression patterns

    • Identification of biomarkers for patient stratification in future clinical applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.