Recombinant Mouse Cytochrome b-c1 complex subunit Rieske, mitochondrial (Uqcrfs1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize developing the specified tag.
Synonyms
Uqcrfs1; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Cytochrome b-c1 complex subunit 5; Rieske iron-sulfur protein; RISP; Rieske protein UQCRFS1; Ubiquinol-cytochrome c reductase iron-sulfur subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
79-274
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVS SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP QHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL EVPAYEFTSDDVVVVG
Uniprot No.

Target Background

Function
Recombinant Mouse Cytochrome b-c1 complex subunit Rieske, mitochondrial (Uqcrfs1) is a component of the ubiquinol-cytochrome c oxidoreductase, a multi-subunit transmembrane complex within the mitochondrial electron transport chain. This complex drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. The cytochrome b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, coupling this redox reaction to proton translocation across the inner mitochondrial membrane via the Q cycle. Two protons are consumed from the matrix, four are released into the intermembrane space, and two electrons are transferred to cytochrome c. The Rieske iron-sulfur protein is a catalytic core subunit containing a [2Fe-2S] cluster. UQCRFS1 undergoes proteolytic processing upon incorporation into the complex III dimer. A fragment, termed subunit 9, corresponds to its mitochondrial targeting sequence (MTS). This processing is crucial for correct insertion into the complex III dimer; however, the persistence of UQCRFS1-derived fragments may hinder processing and assembly of newly imported UQCRFS1, negatively impacting complex III structure and function.
Gene References Into Functions
  1. UQCRFS1 produces N-terminal polypeptides that remain bound to holocomplex III. Under normal conditions, these fragments are rapidly removed; however, in the absence of TTC19, they accumulate within complex III, impairing its structure and function. PMID: 28673544
  2. The Rieske iron-sulfur protein is essential for superoxide generation at Complex III. PMID: 23328522
  3. Mitochondrial respiratory complexes (CI and CIV) and supercomplexes were reduced in RISP-deficient cells. PMID: 22106410
  4. A 3' UTR modification of the mitochondrial Rieske iron-sulfur protein in mice results in a specific skin pigmentation phenotype. PMID: 18401429
Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the fundamental role of Cytochrome b-c1 complex subunit Rieske (Uqcrfs1) in mitochondrial function?

Uqcrfs1 functions as a key catalytic subunit of the ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, Complex III), which is an integral component of the mitochondrial electron transport chain driving oxidative phosphorylation. The Rieske protein contains a [2Fe-2S] iron-sulfur cluster and plays a crucial role in the Q cycle by cycling between two conformational states during catalysis. This conformational cycling enables electron transfer from ubiquinol bound at the Q(o) site in cytochrome b to cytochrome c1, thereby facilitating proton translocation across the inner mitochondrial membrane . The Rieske FeS protein is notably distinguished as the only ubiquitous essential protein identified across cytochrome bc1 complexes in both bacteria and mitochondria, as well as in cytochrome b6f complexes of chloroplasts .

What experimental approaches can be used to detect and quantify Uqcrfs1 in mitochondrial samples?

Multiple analytical methods are available for Uqcrfs1 detection in experimental settings:

  • Western Blotting: Anti-Uqcrfs1 antibodies, such as mouse monoclonal antibodies (e.g., ab14746), can be used to detect Uqcrfs1 in mitochondrial preparations. These antibodies typically recognize three protein forms (precursor/intermediate/mature) in mitochondrial extracts . For optimal detection, 30-120 μg of mitochondrial protein is recommended, depending on expression levels.

  • Flow Cytometry: Antibodies suitable for flow cytometry can be employed for analysis of Uqcrfs1 expression in intact cells, allowing quantification across cell populations .

  • Immunohistochemistry: Paraffin-embedded tissue sections can be probed for Uqcrfs1 expression patterns using IHC-compatible antibodies, enabling spatial visualization of Uqcrfs1 distribution .

  • Activity Assays: Functional assessment can be conducted by measuring ubiquinol:cytochrome c oxidoreductase activity, expressed as nanomoles of cytochrome c reduced per minute per milligram of mitochondrial proteins .

What strategies can be employed to study conformational changes in the Rieske protein during the catalytic cycle?

Investigating the dynamic conformational changes of the Rieske protein during catalysis requires sophisticated methodological approaches:

  • Cryo-Electron Microscopy (Cryo-EM): High-resolution cryo-EM (reaching ~2.9 Å resolution) has emerged as a powerful technique for visualizing alternative conformations of the Rieske subunit during the Q-cycle. This approach allows researchers to capture different structural states of the protein and correlate them with occupancy of the Q(o) site .

  • Styrene-Maleic Acid (SMA) Copolymer Purification: This method preserves native lipid environment and quinone binding, enabling structure determination of the complex in its near-native state. The approach has proven valuable for retaining labile subunits and maintaining higher catalytic activity compared to detergent-based purification methods .

  • Site-Directed Mutagenesis: Systematic modification of key residues in the hinge region of the Rieske protein can provide insights into how conformational changes influence electron transfer efficiency. Mutations that restrict the mobility of the Rieske head domain can be particularly informative for understanding the relationship between structural dynamics and function.

  • Cross-linking Combined with Mass Spectrometry: This technique can capture transient interactions between the Rieske protein and other complex subunits during different stages of the catalytic cycle, providing snapshots of the conformational changes that occur during electron transfer.

How can researchers effectively express and purify recombinant mouse Uqcrfs1 while maintaining its functional properties?

Expression and purification of functional recombinant Uqcrfs1 requires careful consideration of several factors:

  • Expression Systems:

    • Bacterial Systems: While E. coli systems offer high yield, they often fail to properly incorporate the iron-sulfur cluster. Supplementation with iron and sulfur sources and co-expression with iron-sulfur cluster assembly proteins can improve yield of functional protein.

    • Yeast Expression: Saccharomyces cerevisiae or Pichia pastoris systems provide eukaryotic post-translational modifications and can be engineered to overexpress Uqcrfs1, particularly when the endogenous RIP1 gene is deleted .

    • Mammalian Cell Expression: HEK293 or CHO cell lines can produce properly folded protein with native post-translational modifications, though at lower yields.

  • Purification Strategy:

    • Initial isolation of mitochondria using differential centrifugation

    • Solubilization with mild detergents (digitonin, n-dodecyl-β-D-maltoside) or SMA copolymer for nanodisc formation

    • Multi-step chromatography involving ion exchange, hydroxyapatite, and size exclusion techniques

    • Affinity purification using engineered tags (His, FLAG) placed at positions that don't interfere with folding or function

  • Functional Assessment:

    • Spectroscopic verification of [2Fe-2S] cluster incorporation (characteristic absorption at ~460 nm)

    • Electron transfer activity measurements using cytochrome c reduction assays

    • Thermal stability analysis to ensure proper folding

What are the main challenges in studying Uqcrfs1 function in knockout or knockdown models, and how can they be addressed?

Studying Uqcrfs1 function through genetic manipulation presents several challenges:

  • Embryonic Lethality: Complete knockout of Uqcrfs1 in mice is potentially lethal due to its essential role in respiration. Researchers can address this through:

    • Conditional knockout systems (Cre-loxP) with tissue-specific or inducible promoters

    • Hypomorphic alleles that reduce but don't eliminate expression

    • Heterozygous models examining haploinsufficiency effects

  • Compensatory Mechanisms: Long-term knockdown models may develop compensatory upregulation of alternative pathways. Strategies to address this include:

    • Acute knockdown using inducible shRNA systems

    • CRISPR interference (CRISPRi) for transient repression

    • Parallel metabolomic analysis to identify compensatory pathways

  • Functional Assessment: Distinguishing primary from secondary effects requires:

    • Detailed time-course studies following knockdown

    • Rescue experiments with wild-type and mutant constructs

    • Simultaneous monitoring of multiple mitochondrial parameters (membrane potential, ROS production, ATP synthesis)

  • Tissue-Specific Effects: Different tissues show varying sensitivity to Uqcrfs1 deficiency. Researchers should:

    • Employ tissue-specific promoters for targeted knockdown

    • Conduct comparative studies across multiple tissues

    • Consider the impact of metabolic profiles of different cell types

What experimental approaches can resolve data inconsistencies when measuring Complex III activity in samples with altered Uqcrfs1 expression?

Resolving inconsistencies in Complex III activity measurements requires systematic methodology optimization:

MethodResolution ApproachAdvantagesLimitations
Spectrophotometric AssaysStandardize substrate concentrations (ubiquinol, cytochrome c); Control for temperature and pH; Include specific inhibitors (antimycin A, myxothiazol)Quantitative; High throughputIndirect measure; Susceptible to interference
Polarographic MethodsCalibrate oxygen electrodes; Permeabilize cells with digitonin; Supply multiple substrates sequentiallyDirect measure of oxygen consumptionRequires specialized equipment; Lower throughput
Blue Native PAGEOptimize detergent:protein ratios; Include in-gel activity assaysPreserves complex integrity; Visualizes supercomplexesSemi-quantitative; Extraction efficiency varies
Isolated Mitochondria vs. Whole CellsCompare results from both preparationsIsolated mitochondria provide cleaner backgroundMitochondrial isolation may disrupt supercomplexes

Researchers should note that the functional activity of Uqcrfs1 in mitochondrial preparations can vary significantly based on extraction and measurement conditions. For example, studies have shown that mitochondrially encoded Rieske protein (RIP1m) exhibits approximately 9% of wild-type activity (236 ± 66 vs. 2,609 ± 244 nanomoles of cytochrome c reduced per minute per milligram of mitochondrial proteins) , highlighting the importance of appropriate controls and standardized measurement conditions.

How does the structure-function relationship of Uqcrfs1 compare between species, and what are the implications for using mouse models in mitochondrial disease research?

The evolutionary conservation and structural variations of Uqcrfs1 across species have important implications:

  • Structural Conservation:

    • The Rieske FeS protein represents one of the most highly conserved components of cytochrome bc1 complexes across species from bacteria to mammals .

    • The catalytic [2Fe-2S] cluster domain and key functional residues show remarkable preservation across evolution.

    • The position of the transmembrane helix relative to other complex components is largely conserved, though some differences exist in membrane-extrinsic domains.

  • Functional Variations:

    • Processing mechanisms differ between species: while mitochondrial Uqcrfs1 undergoes proteolytic processing after incorporation into Complex III , bacterial homologs may use different maturation pathways.

    • The requirement for accessory factors in assembly varies between species, with mammalian systems typically requiring more elaborate assembly factors.

    • Catalytic efficiency and inhibitor sensitivity show species-specific differences that should be considered when extrapolating from mouse to human studies.

  • Implications for Mouse Models:

    • Mouse Uqcrfs1 shares high sequence homology with human UQCRFS1, making it suitable for modeling many aspects of human mitochondrial function.

    • Differences in nuclear-mitochondrial genetic interactions between species may affect the phenotypic expression of mutations.

    • Tissue-specific expression patterns and metabolic requirements differ between mice and humans, potentially affecting the presentation of Uqcrfs1-related deficiencies.

  • Comparative Analysis Tools:

    • Sequence alignment and structural superimposition of Uqcrfs1 from different species

    • Cross-species complementation studies (e.g., human UQCRFS1 in mouse models)

    • Evolutionary rate analysis to identify critical vs. adaptable regions

What is the relationship between Uqcrfs1 and supernumerary subunits in Complex III assembly and stability?

The relationship between Uqcrfs1 and supernumerary subunits reveals important structural and functional interactions:

  • Evolutionary Context:

    • Bacterial cytochrome bc1 complexes (such as those from Rhodobacter capsulatus or Paracoccus denitrificans) contain only three core subunits: cytochrome b, cytochrome c1, and the Rieske subunit .

    • Mitochondrial Complex III has acquired additional supernumerary subunits during evolution, with seven in yeast and plants and eight in mammals .

    • These supernumerary subunits likely evolved to stabilize the complex and regulate its activity in the more complex eukaryotic environment.

  • Structural Interactions:

    • In mitochondrial Complex III, the 7.2-kDa supernumerary subunit (yeast QCR9 or mammalian UQCR10) occupies a position similar to that of subunit IV (SIV) in bacterial complexes such as Rhodobacter sphaeroides .

    • The transmembrane helix of SIV in R. sphaeroides interacts with the Rieske and cytochrome c1 subunits, rather than with cytochrome b as previously proposed .

    • These interactions appear critical for stabilizing the complex, particularly at the dimer interface.

  • Functional Significance:

    • Complexes lacking supernumerary subunits show reduced activity and stability. For example, the four-subunit cytochrome bc1 complex from R. sphaeroides (with SIV present) exhibits threefold higher activity than complexes lacking SIV .

    • Supernumerary subunits like QCR9/UQCR10 are required for correct incorporation of the Rieske subunit and stabilization of the dimeric complex .

    • The transmembrane helix appears to be the primary functional domain of these supernumerary subunits, as demonstrated by studies showing that the acidic C-terminal region of yeast QCR9 is not needed for function .

  • Experimental Approaches:

    • Comparative activity assays between complete complexes and those lacking specific supernumerary subunits

    • Structural analysis using cryo-EM to visualize interaction interfaces

    • Mutagenesis studies targeting interaction surfaces between Uqcrfs1 and supernumerary subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.