Recombinant Mouse Cytochrome b5 type B (Cyb5b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please specify them during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior communication and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cyb5b; Cyb5m; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-146
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
KVEGSEPSVTYYRLEEVAKRNSAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNSCQSSWAYWFVPIVGAILIGFLYRHFWADSKSS
Uniprot No.

Target Background

Function

Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases.

Gene References Into Functions
  1. A novel reductive enzyme system crucial for lipid synthesis, exclusively located in the outer mitochondrial membrane, comprises CYB5B, MOSC2, and an unidentified component (a CYB5B reductase). PMID: 22203676
  2. Microsomal cytochrome b5 interacts with the neuronal calcium sensor protein, visinin-like protein-3, in a calcium-dependent manner. PMID: 14739275
  3. Sphinganine C-4 hydroxylation (dihydroceramide hydroxylation) requires complex formation between Des2 and mb5 via their membrane-spanning domains and electron transfer from NADH to the substrate through mb5 reduction by b5R. PMID: 16571104
  4. Microsomal cytochrome b5 plays a significant role in the in vivo metabolism of certain drugs and chemicals, but this role is P450- and substrate-dependent. PMID: 18805792
Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
Mitochondrion outer membrane.

Q&A

What is Cytochrome b5 type B (Cyb5b) and what are its primary functions?

Cytochrome b5 type B (Cyb5b) is a membrane-bound hemoprotein that functions primarily as an electron carrier for membrane-bound oxygenases. As a member of the cytochrome b5 family, it is crucial for various electron transfer processes in cellular metabolism. In mice, as in humans, Cyb5b is encoded by the Cyb5b gene and contains specific binding motifs for heme prosthetic groups that are essential for its electron transfer capabilities .

Unlike some cytochrome b5 variants, Cyb5b belongs to a class of cytochrome b-type proteins that can participate in NAD(P)H oxidoreductase activity. This activity is demonstrated through its ability to produce superoxide in the presence of air and excess NAD(P)H, as well as its capacity to reduce cytochrome c in vitro . These functional characteristics make Cyb5b a potential oxygen sensor in mammalian systems, in addition to its roles in various metabolic pathways.

Cytochrome b-type NAD(P)H oxidoreductases like Cyb5b are involved in numerous physiological processes, including iron uptake in yeast, respiratory burst in immune cells, and oxygen sensing mechanisms in mammals . The structural and functional conservation of these proteins across species highlights their fundamental importance in cellular physiology.

What expression systems are most effective for producing functional recombinant mouse Cyb5b?

Multiple expression systems have been successfully employed for the production of recombinant mouse Cyb5b, each offering distinct advantages depending on research requirements. The choice of expression system significantly impacts protein yield, folding, post-translational modifications, and ultimately, functional activity.

The most commonly used expression systems include:

Expression SystemAdvantagesConsiderations
E. coli (in vitro)High yield, cost-effective, suitable for structural studiesMay lack post-translational modifications, potential inclusion body formation
YeastBetter protein folding, some post-translational modificationsLonger production time, moderate yield
BaculovirusSuperior folding, extensive post-translational modificationsMore complex system, higher cost, moderate yield
Mammalian cellNative-like modifications, proper protein foldingLowest yield, highest cost, most complex system

For mouse Cyb5b specifically, E. coli expression systems using vectors such as pET22b and pET19b have been successfully employed . When expressing Cyb5b in E. coli, it's important to consider whether a polyhistidine tag is desired for purification purposes. The pET19b vector is often used when a 6-His tag is needed at the N-terminus of the protein .

For applications requiring native-like protein with proper post-translational modifications, mammalian expression systems may be preferable despite their lower yield. The choice ultimately depends on the specific research questions being addressed and the downstream applications of the recombinant protein.

What purification strategies yield the highest purity and activity for recombinant mouse Cyb5b?

Purification of recombinant mouse Cyb5b requires a strategic approach to maintain protein integrity while achieving high purity. The following multi-step purification protocol has proven effective:

  • Initial Extraction: For E. coli-expressed Cyb5b, cell lysis using either sonication or French press in buffer containing protease inhibitors is crucial to prevent degradation. The lysis buffer typically contains 50 mM sodium phosphate (pH 7.0-7.5), 150 mM NaCl, and appropriate protease inhibitors.

  • Primary Purification: The choice of initial purification step depends on the protein construct:

    • For His-tagged Cyb5b, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins provides efficient capture.

    • For non-tagged constructs, ion exchange chromatography (typically using a DEAE or Q-Sepharose column) can be employed based on the protein's isoelectric point.

  • Secondary Purification: Size exclusion chromatography serves as an effective polishing step, not only improving purity but also allowing buffer exchange and assessment of the protein's oligomeric state.

  • Quality Control: The purified protein should be assessed for:

    • Purity: SDS-PAGE analysis should show >95% purity

    • Functional integrity: UV-visible spectroscopy to confirm proper heme incorporation, with characteristic Soret band at 413 nm (oxidized) shifting to 425 nm upon reduction

    • Homogeneity: Dynamic light scattering to confirm monodispersity

For applications requiring the highest purity, additional chromatographic steps may be incorporated, such as hydroxyapatite chromatography or hydrophobic interaction chromatography. The choice of purification strategy should be tailored to the specific downstream applications, with particular attention to maintaining the native conformation and heme incorporation that are essential for Cyb5b activity .

How can researchers accurately measure and interpret the electron transfer kinetics of recombinant mouse Cyb5b?

Measuring electron transfer kinetics of recombinant mouse Cyb5b requires specialized techniques and careful experimental design. The following methodology has been established as reliable for accurate kinetic analysis:

Experimental Setup for Interdomain Electron Transfer:

  • Measurements must be conducted under oxygen-free conditions using a regulated gas flow device to prevent auto-oxidation that would confound results.

  • The substrate and reductant mixture should be equilibrated with high-purity nitrogen (>99.999%) for approximately 30 minutes in a reaction vessel.

  • Upon injection of the reductase component, the mixture is transferred to a sealed quartz cuvette in a spectrophotometer.

  • Reduction of the heme is monitored by the increase in absorbance at the Soret band (ε424 ≈ 120 mM-1 cm-1 for cytochrome b5 proteins) .

Data Collection and Analysis:

  • Kinetic data typically fit to a single exponential function, with the resulting pseudo-first order rate constant dissolved by the appropriate enzyme concentration to obtain observed rate constants (min-1 μM-1).

  • Buffer conditions significantly impact electron transfer rates. Common conditions include 5 mM sodium phosphate and 50 mM sodium phosphate (pH 7.0), which provide ionic strengths (μ) of 0.009 and 0.108 M, respectively .

  • For determination of Michaelis-Menten parameters, Cyb5b (0.7-100 μM) can be reduced by its corresponding reductase domain in the presence of excess NADH (100 μM) under anaerobic conditions.

Reaction Monitoring Strategies:

  • For lower substrate concentrations (≤10 μM), monitor the absorbance increase of the Soret band (A424).

  • For higher substrate concentrations (≥10 μM), monitor the β-peak (ε558 ≈ 17.5 mM-1 cm-1) .

  • Apply the Michaelis-Menten equation to fit initial rate (V0) and substrate concentration [S] data to generate Km and Vmax values.

Importantly, unlike some cytochrome b5 systems that fit well to standard non-linear functions, Cyb5b pairs may require omission of the (0,0) point for proper data fitting due to observed y-intercept values that differ from zero . This methodological consideration is critical for obtaining accurate kinetic parameters.

What spectroscopic methods provide the most valuable information for characterizing recombinant mouse Cyb5b?

Characterization of recombinant mouse Cyb5b relies heavily on various spectroscopic techniques, each providing specific insights into different aspects of the protein's structure and function:

UV-Visible Absorption Spectroscopy:
This fundamental technique provides immediate confirmation of proper heme incorporation and functional status of Cyb5b. Key spectral features include:

  • Oxidized Cyb5b exhibits a characteristic Soret band at approximately 413 nm

  • Upon reduction with NAD(P)H, distinctive spectral shifts occur:

    • Soret band shifts to about 425 nm

    • Alpha and beta bands appear at approximately 557 and 527 nm, respectively

These spectral signatures serve as diagnostic markers for properly folded, heme-containing Cyb5b and can be used to quantify protein concentration using established extinction coefficients.

Circular Dichroism (CD) Spectroscopy:
While not explicitly mentioned in the search results, CD spectroscopy is essential for assessing secondary structure content and proper folding of recombinant proteins like Cyb5b:

  • Far-UV CD (190-250 nm) reveals the proportions of alpha-helical, beta-sheet, and random coil structures

  • Near-UV CD (250-350 nm) provides insights into the tertiary structure environment around aromatic residues

  • Thermal denaturation studies monitored by CD can assess protein stability and the impact of mutations or buffer conditions

Electron Paramagnetic Resonance (EPR) Spectroscopy:
For heme-containing proteins like Cyb5b, EPR spectroscopy provides detailed information about the electronic structure of the heme iron in its paramagnetic states, offering insights into coordination environment and oxidation state.

Resonance Raman Spectroscopy:
This technique is particularly informative for heme-containing proteins, providing detailed information about the heme environment, including coordination state, spin state, and heme-protein interactions.

A comprehensive characterization approach would typically begin with UV-visible spectroscopy for initial quality assessment, followed by more specialized techniques to probe specific structural and functional aspects of the recombinant protein .

How do mutations in specific residues affect the functional activity and stability of recombinant mouse Cyb5b?

The functional activity and stability of recombinant mouse Cyb5b can be significantly influenced by specific mutations, particularly those affecting key residues involved in heme binding, redox partner interactions, or protein folding. Structure-function studies of cytochrome b5 proteins have revealed several critical residues whose mutation can have profound effects:

Heme-Binding Pocket Mutations:
Mutations affecting the heme-binding region have the most direct impact on function. For example:

  • Mutations of the conserved histidine residues that coordinate the heme iron typically result in complete loss of heme binding and electron transfer capacity

  • Alterations to residues forming the hydrophobic heme pocket affect the redox potential by modifying the electronic environment around the heme

  • Specific mutations like R113A and W114A have been studied in related cytochrome b5 domains, demonstrating the importance of these residues in maintaining proper heme orientation and stability

Surface Residue Modifications:
Charged residues on the protein surface play crucial roles in electrostatic interactions with redox partners:

  • Mutations that alter the distribution of surface charges can significantly impact electron transfer rates even when the core structure remains intact

  • These effects can be quantified through interdomain electron transfer assays, which measure the efficiency of electron transfer between Cyb5b and its redox partners

Experimental Approaches for Mutation Studies:
Site-directed mutagenesis using techniques like the QuikChange method enables precise introduction of desired mutations . The impact of mutations can then be assessed through:

  • Spectroscopic analysis to evaluate heme incorporation and environment

  • Kinetic measurements to determine effects on electron transfer rates

  • Thermal stability assays to assess structural integrity

  • Crystallographic studies to visualize structural perturbations

Understanding the effects of specific mutations provides valuable insights into the structure-function relationships governing Cyb5b activity and can guide rational protein engineering efforts aimed at enhancing stability or modifying functional properties for specific research applications.

What are the key differences between in vitro and in vivo behavior of recombinant mouse Cyb5b?

Understanding the disparities between in vitro and in vivo behavior of recombinant mouse Cyb5b is crucial for correctly interpreting experimental results and extrapolating findings to physiological contexts. Several key factors contribute to these differences:

Membrane Environment:
In vivo, Cyb5b exists in a complex membrane environment that significantly influences its orientation, dynamics, and interactions with partner proteins. This native membrane context is difficult to replicate in vitro:

  • The lipid composition of mitochondrial membranes, including specific phospholipids and cardiolipin, affects protein insertion and mobility

  • Membrane potential may influence the conformation and activity of membrane-associated Cyb5b

  • In vitro studies often use detergent-solubilized protein or simplified membrane mimetics that do not fully recapitulate the native environment

Redox Partner Accessibility:
The spatial organization and concentration of redox partners in vivo differs substantially from typical in vitro experimental conditions:

  • In vivo, specific protein-protein interactions may be regulated by cellular compartmentalization or scaffolding proteins

  • The effective local concentration of interaction partners in cellular membranes may be much higher than those used in solution-based in vitro assays

  • The simultaneous presence of multiple potential redox partners in vivo creates competition that is rarely replicated in vitro

Post-translational Modifications:
Depending on the expression system used, recombinant Cyb5b may lack important post-translational modifications that occur in vivo:

  • E. coli-expressed protein lacks eukaryotic modifications that might affect function or stability

  • Even mammalian expression systems may not perfectly replicate the specific modifications present in mouse tissue

  • These modifications can influence protein-protein interactions, subcellular localization, and catalytic properties

Methodological Strategies to Bridge the Gap:
To address these discrepancies, researchers can employ several approaches:

  • Use more complex membrane mimetic systems like liposomes with native-like lipid composition

  • Express recombinant protein in mouse cell lines to better preserve native modifications

  • Perform parallel in vitro and cell-based assays to correlate findings across systems

  • Validate key findings using native Cyb5b isolated from mouse tissues

By accounting for these differences, researchers can develop more physiologically relevant experimental systems and better translate their in vitro findings to in vivo contexts.

What emerging technologies show promise for studying Cyb5b interactions with membrane systems?

Several cutting-edge technologies are expanding our ability to study the complex interactions between Cyb5b and membrane systems with unprecedented detail. These approaches offer new insights into the dynamic behavior of Cyb5b in its native environment:

Advanced Membrane Mimetic Systems:

  • Nanodiscs: These disc-shaped phospholipid bilayers encircled by membrane scaffold proteins provide a native-like membrane environment with defined size. They allow precise control of lipid composition and protein stoichiometry while maintaining a native-like bilayer structure.

  • Polymer-supported membranes: These systems offer improved stability compared to traditional supported lipid bilayers while still enabling the application of surface-sensitive techniques.

  • Cell-derived vesicles: Directly harvested from cells, these vesicles contain near-native lipid compositions and can include the complete membrane proteome, offering a highly physiological context for Cyb5b studies.

High-resolution Imaging and Spectroscopy:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM technology now enable visualization of membrane proteins in near-native environments at near-atomic resolution, potentially revealing the structural basis of Cyb5b-membrane interactions.

  • Super-resolution microscopy: Techniques like STORM and PALM can track the dynamics of individual Cyb5b molecules in membranes with nanometer precision, revealing spatial organization and diffusion properties.

  • Neutron reflectometry: This technique provides detailed structural information about the organization of proteins within membranes, distinguishing between peripheral association and transmembrane insertion.

Novel Biophysical Approaches:

  • Single-molecule Förster Resonance Energy Transfer (smFRET): By labeling specific sites on Cyb5b and its interaction partners, researchers can monitor conformational changes and binding events at the single-molecule level.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of Cyb5b that become protected upon membrane binding, providing insights into the protein-membrane interface.

  • Native mass spectrometry: Recent advances allow the analysis of intact membrane protein complexes, potentially revealing the stoichiometry and stability of Cyb5b interactions with partner proteins.

These emerging technologies, particularly when used in combination, promise to provide a more complete understanding of how Cyb5b functions within membrane environments and interacts with its various redox partners in physiologically relevant contexts.

What are the most promising applications of recombinant mouse Cyb5b in biomedical research?

Recombinant mouse Cyb5b offers significant potential for advancing several areas of biomedical research, with applications that extend from basic science to therapeutic development:

Oxidative Stress and Redox Biology Studies:
Cyb5b's role as a cytochrome b-type NAD(P)H oxidoreductase makes it valuable for investigating cellular redox processes . As a potential oxygen sensor and superoxide producer, it may provide insights into:

  • Mechanisms of oxidative stress in various pathological conditions

  • Cellular responses to hypoxia and reoxygenation

  • Redox signaling pathways in normal physiology and disease states

Metabolic Disease Research:
Emerging evidence suggests that cytochrome b5 proteins play important roles in metabolism, particularly lipid metabolism:

  • Studies using recombinant Cyb5b can elucidate its contribution to fatty acid desaturation and elongation pathways

  • Altered cytochrome b5 function has been implicated in metabolic disorders, making Cyb5b a potential target for investigating these conditions

  • Mouse models with modified Cyb5b expression may provide insights into metabolic regulation

Drug Metabolism and Pharmacokinetics:
Cytochrome b5 proteins modulate the activity of cytochrome P450 enzymes, which are critical for drug metabolism:

  • Recombinant Cyb5b can be used in reconstituted systems to study its effects on drug-metabolizing enzymes

  • Understanding these interactions may improve predictions of drug metabolism and potential drug-drug interactions

  • Species-specific differences in Cyb5b structure and function may explain some variations in drug metabolism between humans and model organisms

Therapeutic Target and Tool Development:
The unique properties of Cyb5b open several possibilities for therapeutic applications:

  • As a potential oxygen sensor, Cyb5b might be targeted to modulate hypoxic signaling in conditions like ischemia or cancer

  • Engineered variants of Cyb5b could serve as biosensors for detecting redox changes in cellular systems

  • Understanding Cyb5b structure and function may enable the development of small-molecule modulators with therapeutic potential

The availability of high-quality recombinant mouse Cyb5b from various expression systems facilitates these research directions by providing consistent, well-characterized material for experimental studies. As our understanding of Cyb5b's roles in cellular physiology continues to expand, new applications are likely to emerge in both basic and translational research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.