Recombinant Mouse Cytochrome b561 domain-containing protein 1 (Cyb561d1)

Shipped with Ice Packs
In Stock

Description

Key Spectral Properties

PropertyMm_CYB561D1 ValueMethod
Soret peak absorbance~413 nmOptical spectroscopy
Ascorbate reduction (K₁)0.045 ± 0.007 mMRedox titration
Ascorbate reduction (K₂)2.34 ± 0.50 mMRedox titration
EPR signalsDominant g_z = 3.69 peakLow-temperature EPR

Purification challenges (e.g., high A₂₈₀/Aₛₒᵣₑₜ ratio due to contaminants) were noted in recombinant samples expressed in yeast membranes .

Electron Transfer Mechanism

  • Mm_CYB561D1 demonstrates transmembrane electron transport via ascorbate reducibility, a hallmark of CYB561 proteins .

  • The two heme centers enable sequential electron transfer across the membrane, with redox potentials comparable to homologs like Hs_CYB561D2 .

Putative Roles in Physiology and Pathology

  • Iron metabolism: CYB561 family members are implicated in ferric reductase activity and ascorbate recycling, though direct evidence for Mm_CYB561D1 remains limited .

  • Cancer associations: Human homologs (e.g., Hs_CYB561D1/D2) are linked to tumor suppression or progression, but Mm_CYB561D1’s role in murine cancer models is underexplored .

Comparative Analysis with CYB561 Family Members

ProteinOrganismKey PropertiesReference
Mm_CYB561D1MouseK₁ = 0.045 mM, K₂ = 2.34 mM; HALS heme centers
Hs_CYB561D2HumanTumor suppressor; similar redox behavior
D. melanogasterInsectOrthologs show ferric reductase activity

Research Gaps and Future Directions

  • Functional validation: No direct evidence yet links Mm_CYB561D1 to tumorigenesis or iron metabolism in vivo.

  • Structural resolution: High-resolution crystallography is needed to confirm homology modeling predictions .

  • Therapeutic potential: Human CYB561 homologs are emerging targets in breast and prostate cancers , suggesting Mm_CYB561D1 could serve as a murine model for mechanistic studies.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
Cyb561d1; Probable transmembrane reductase CYB561D1; Cytochrome b561 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Cyb561d1
Target Protein Sequence
MHSMEVGLVPAPAREPRLTRWLRRGSGILAHLIALGFTIFLTVLSRPGTSLFSWHPVFMA LAFCLCMAEAILLFSPEHSLFFFCSRKTRIRLHWAGQTMAILCAVLGLGFIISSKIRSEM SHLVSWHSWIGALTLLATGGQALCGLCLLCPRAARVSRVARLKLYHLTCGLVVYLMATVT VLLGMYSVWFQAQIKGTAWYLCLGLPLYPALVIMHQISSSYLPRKKVEI
Uniprot No.

Target Background

Function

Probable transmembrane reductase. It may utilize ascorbate as an electron donor, transferring electrons across membranes to reduce monodehydro-L-ascorbate radical and ferric iron (Fe3+) in a different cellular compartment.

Database Links

KEGG: mmu:72023

UniGene: Mm.246391

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse Cytochrome b561 domain-containing protein 1 (Cyb561d1)?

Mouse Cytochrome b561 domain-containing protein 1 (Mm_CYB561D1) is an integral membrane protein belonging to the Cytochrome b561 family. It features six transmembrane domains with two heme-b redox centers, one located on each side of the host membrane. The protein consists of 229 amino acids and shares 90% identity and 95% similarity with its human ortholog (Hs_CYB561D1) . Like other members of the CYB561 family, Mm_CYB561D1 has four highly conserved histidine residues in the central four transmembrane helices that coordinate the two heme-b chromophores . This structural arrangement enables the protein's characteristic ability to transfer electrons across membranes.

What are the spectroscopic characteristics of recombinant Mm_CYB561D1?

Recombinant Mm_CYB561D1 demonstrates distinctive spectroscopic properties consistent with its classification as a b-type cytochrome. The protein exhibits maximum absorbance at approximately 561 nm in its redox absorption spectrum, which is characteristic of the CYB561 family . Circular dichroism (CD) spectroscopy of Mm_CYB561D1 reveals no significant exciton splitting in either the oxidized or reduced state, indicating minimal electronic interaction between the two heme-b chromophores . This finding differs from some other CYB561 proteins where such interactions are more pronounced. Additionally, electron paramagnetic resonance (EPR) studies show that both hemes in Mm_CYB561D1 display a highly asymmetric low-spin (HALS) character, with no significant EPR peak around g₂ = 3.16, which is usually assigned to rhombic heme environments in other cytochrome b561 proteins .

How do the redox properties of Mm_CYB561D1 compare to other CYB561 family members?

Mm_CYB561D1 demonstrates ascorbate reducibility with two characteristic ascorbate concentration values: K₁ = 0.045 ± 0.007 mM and K₂ = 2.34 ± 0.50 mM . These values represent the ascorbate concentrations at which half of either of the two heme-b centers in the protein is reduced. Redox titration experiments have revealed two distinct midpoint reduction potentials: 144 ± 7 mV (high potential) and -19 ± 4 mV (low potential) . The difference between these two reduction potentials (approximately 163 mV) is notably larger than what is typically observed in other CYB561 proteins, as shown in the comparative table below:

CYB561 ProteinExpression SystemHigh-Affinity Asc Binding Site (mM)Low-Affinity Asc Binding Site (mM)Reduction Potentials (mV)
E highE low
Bt_CYB561A1none??15060
Bt_CYB561A1E.coli0.00530.39417181
Mm_CYB561A1S.cerevisiae0.0161.2416020
Mm_CYB561D1S.cerevisiae0.0452.34144-19

This data indicates that while Mm_CYB561D1 shares fundamental redox properties with other family members, it has distinct electrochemical characteristics that may relate to its specific biological functions .

Where is Mm_CYB561D1 primarily expressed in mouse tissues?

Expression analysis of the mouse Cyb561d1 gene has revealed highest expression levels in specific immune and digestive tissues, particularly thymus, spleen, colon, and large intestine . This expression pattern differs somewhat from other CYB561 family members and suggests potential specialized functions in these tissues. The distinct tissue distribution may indicate roles in immune function, digestive processes, or specialized redox activities in these organs. Understanding this tissue-specific expression is crucial for investigating the protein's physiological functions and potential implications in disease states.

What expression systems have been successfully used for recombinant production of Mm_CYB561D1?

Successful recombinant expression of Mm_CYB561D1 has been achieved using Saccharomyces cerevisiae (yeast) as an expression system . This approach enables the production of functional protein that maintains its characteristic spectral and redox properties. The methodology typically involves introducing the Mm_CYB561D1 gene into yeast expression vectors, followed by transformation and induction of protein expression. Cell-free protein synthesis (CFPS) systems have also been employed for the production of CYB561 family proteins, including human CYB561D1 . Each expression system offers distinct advantages and challenges for the production of this integral membrane protein, with yeast systems generally providing a eukaryotic environment that supports proper folding and membrane insertion.

What is the proposed biological function of Cyb561d1 proteins?

Cytochrome b561 family proteins, including Cyb561d1, contribute to multiple physiological processes through their fundamental ability to transfer electrons across membranes and recycle ascorbic acid . Specifically, they are implicated in iron metabolism regulation through their electron transport capabilities . For Cyb561d1 specifically, evidence suggests involvement in tumor suppression pathways, though the exact mechanisms remain under investigation . The human ortholog (Hs_CYB561D1) has been detected in multiple tissues and shows gene activity in various biological processes, including tumor-related processes, blocking mitosis in certain cell lines, upregulation of Retinoid X receptor expression in pancreatic β-cells, and roles in aging, type 2 diabetes, and cognitive function . These diverse associations suggest Cyb561d1 proteins may serve as important redox regulators in multiple cellular pathways, with tissue-specific functions determined by their particular expression patterns.

How can researchers effectively study electron transfer mechanisms in Mm_CYB561D1?

Investigating electron transfer mechanisms in Mm_CYB561D1 requires a multi-faceted approach combining spectroscopic, electrochemical, and computational methods. Researchers can employ:

  • Ascorbate titration experiments to assess the protein's ability to accept electrons from ascorbate and determine binding constants for potential ascorbate binding sites .

  • Redox titration using dithionite under anaerobic conditions to determine midpoint reduction potentials of the heme centers and analyze electron transfer pathways .

  • Spectroscopic methods including UV-visible absorption spectroscopy, circular dichroism (CD), and electron paramagnetic resonance (EPR) to characterize the electronic properties of the heme centers and their interactions .

  • Homology modeling to generate putative 3D structures and predict transmembrane electron transfer pathways based on structural arrangements of key amino acid residues .

  • Site-directed mutagenesis of conserved histidine residues or other amino acids potentially involved in electron transfer to assess their functional importance.

The combination of these approaches allows for comprehensive characterization of electron transfer mechanisms, which is essential for understanding the protein's physiological functions.

What evidence supports the potential role of Cyb561d1 in tumor suppression?

The potential tumor suppression role of Cyb561d1 is suggested by several lines of evidence. Studies have shown that the human Cyb561d1 gene product (Hs_CYB561D1) is involved in various tumorous processes . Additionally, it has been demonstrated to participate in blocking mitosis in both U20S and HeLa cells, suggesting a role in regulating cellular proliferation . The protein shares high sequence similarity (90% identity, 95% similarity) with Cyb561d2, which has more established tumor suppressor functions .

What methodological challenges exist in studying Mm_CYB561D1 and how can they be addressed?

Researchers face several significant challenges when studying Mm_CYB561D1:

  • Protein purification difficulties: As an integral membrane protein, Mm_CYB561D1 presents challenges for high-purity isolation. Even with affinity chromatography approaches, contaminating proteins often remain, as evidenced by higher than expected A(280 nm)-to-A(Soret peak) ratios . This can be partially addressed through optimization of purification protocols, including testing different detergents, solubilization conditions, and multi-step purification strategies.

  • Structural characterization limitations: The membrane-bound nature of Mm_CYB561D1 complicates structural studies like X-ray crystallography. Researchers have relied on homology modeling to predict the protein's 3D structure . Alternative approaches such as cryo-electron microscopy or NMR studies of specific domains may provide additional structural insights.

  • Functional assay development: Assessing the electron transfer function in a controlled experimental setting requires specialized electrochemical and spectroscopic approaches. Development of reconstituted systems or cell-based assays that can monitor electron transfer activities would enhance functional studies.

  • Physiological relevance determination: Connecting biochemical properties to biological functions remains challenging. Knockout/knockdown studies in cellular or animal models, combined with tissue-specific expression analysis and protein-protein interaction studies, may help elucidate physiological roles.

Addressing these challenges requires multidisciplinary approaches combining advanced protein biochemistry, spectroscopy, molecular biology, and computational methods.

How do sequence variations between mouse and human Cyb561d1 affect structure-function relationships?

The mouse and human Cyb561d1 proteins share 90% identity and 95% similarity in their primary sequences, which consists of 229 amino acids in both species . This high degree of conservation suggests that fundamental structural features and functions are likely preserved between the two orthologs. The conserved regions primarily include the transmembrane domains and histidine residues that coordinate the heme groups, which are essential for the electron transfer function.

The 5-10% sequence differences between mouse and human orthologs may contribute to subtle variations in:

  • Protein stability and folding kinetics in different cellular environments

  • Binding affinities for interaction partners or substrates

  • Regulatory mechanisms controlling protein expression or activity

  • Tissue-specific functions that have evolved differently between species

Understanding these species-specific variations is important when extrapolating findings from mouse models to human systems. Comparative studies examining both orthologs under identical experimental conditions would provide valuable insights into how sequence variations impact functional properties and could help identify conserved functional domains that represent potential therapeutic targets.

What are promising future research directions for Mm_CYB561D1 studies?

Future research on Mm_CYB561D1 could productively focus on several promising directions:

  • Detailed structure-function analysis: Resolving the high-resolution structure of Mm_CYB561D1 would significantly advance understanding of its electron transfer mechanisms. Combined with site-directed mutagenesis of key residues, this could elucidate precisely how electrons move through the protein.

  • Physiological substrate identification: While ascorbate reducibility is established, identifying all physiological electron donors and acceptors would clarify the protein's role in cellular redox networks. Proteomics approaches could help identify interaction partners.

  • Tissue-specific function investigation: Given its high expression in thymus, spleen, colon, and large intestine, studies examining tissue-specific knockout models could reveal specialized functions in these tissues and potential phenotypic consequences.

  • Cancer biology connections: Further investigation of the proposed tumor suppression function through gene editing approaches in cancer cell models and tissue analyses could establish mechanistic links between Mm_CYB561D1 and cancer pathology.

  • Therapeutic potential exploration: If tumor suppression functions are confirmed, development of approaches to modulate Cyb561d1 activity could represent a novel therapeutic strategy for certain cancers.

These research directions would collectively advance our understanding of this important protein family and potentially reveal new therapeutic targets for diseases involving dysregulated iron metabolism or cellular redox imbalance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.