Recombinant Mouse Cytochrome b561 domain-containing protein 2 (Cyb561d2)

Shipped with Ice Packs
In Stock

Description

Redox Activity

  • Exhibits ascorbate-dependent reduction of ferric ions (Fe3+Fe2+\text{Fe}^{3+} \rightarrow \text{Fe}^{2+}) via trans-membrane electron transfer .

  • Reduction kinetics show two distinct ascorbate-binding sites with K1=0.045mMK_1 = 0.045 \, \text{mM} and K2=2.34mMK_2 = 2.34 \, \text{mM} .

Functional Partners

Partner ProteinInteraction RoleAssociation Score
NPRL2mTORC1 pathway regulation0.664
FRRS1Ferric-chelate reduction0.642
ZMYND10Axonemal dynein arm assembly0.495

Tumor Suppression Mechanisms

  • Induces caspase-independent apoptosis and autophagy in lung cancer cells .

  • Downregulated in lung tumors compared to normal bronchial epithelium .

Pro-Tumorigenic Roles in Gliomas

  • STAT3 Activation: CYB561D2 overexpression activates STAT3, upregulating immunosuppressive factors PD-L1, CCL2, and TDO2 .

  • Clinical Correlation: High CYB561D2 expression correlates with:

    • Shorter survival in glioblastoma (HR = 1.47, P = 0.0011)

    • Advanced tumor grade (WHO III/IV vs. II; P < 0.001)

Table: CYB561D2-Mediated Immune Evasion

Effector MoleculeFunction in GliomasCorrelation (Spearman r)
PD-L1T-cell inhibition0.19 (P = 0.0003)
CCL2Macrophage recruitment0.33 (P < 0.0001)
TDO2Tryptophan catabolism0.29 (P < 0.0001)

Recombinant Protein Utility

  • Used to generate polyclonal antibodies (e.g., PA5-60137) for immunohistochemistry and Western blotting .

  • Functional assays:

    • In vitro: Redox activity measured via optical spectroscopy .

    • In vivo: Intracranial glioma models show CYB561D2 overexpression reduces survival (blocked by STAT3 inhibitors) .

Ortholog Conservation

  • 95% sequence identity with human CYB561D2 .

  • Cross-species homologs available for zebrafish, rhesus macaque, and human .

Future Directions

  • Therapeutic Targeting: Dual role in cancer (pro- vs. anti-tumor) necessitates context-specific strategies .

  • Mechanistic Studies: Unresolved questions about heme coordination and electron transfer pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for the specific delivery timeframe.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Cyb561d2; 101f6; Transmembrane reductase CYB561D2; Cytochrome b561 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-222
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Cyb561d2
Target Protein Sequence
ALSVETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMT EALLMFSPESSLLRSLSRKVRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLTTRHG QAGLLAVLWAGLQCSGGMGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGSASLLLGMFSL WFTATVTGGAWYLAVLCPILTSLVIMNQVSNAYLYRKRIQP
Uniprot No.

Target Background

Function
Transmembrane reductase that may use ascorbate as an electron donor in the cytoplasm and transfer electrons across endoplasmic reticulum membranes to reduce monodehydro-L-ascorbate radical and iron cations Fe(3+) in the lumen of that compartment.
Gene References Into Functions
  1. show (1) TSCytb's reduced spectra have a split a-band at already low ascorbate concentrations (at already high potential levels), and (2) it has two heme b redox centers, both with positive redox potentials, that differ by about 100 mV from each other PMID: 19943161
  2. 101F6 exhibited ferric as well as azo-dye-reductase activity. PMID: 17938141
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the brain, lung, liver, and kidney. Moderately expressed in the heart, placenta, skeletal muscle, and pancreas.

Q&A

How do recombinant mouse Cyb561d2 proteins differ from their native counterparts?

Recombinant mouse Cyb561d2 proteins are typically produced in expression systems like E. coli and include fusion tags (most commonly His-tags) to facilitate purification and detection. While the core amino acid sequence remains consistent with the native protein, these modifications can affect certain biochemical properties:

  • Tag influence: The His-tag addition at the N-terminus may slightly alter protein folding dynamics

  • Post-translational modifications: E. coli-expressed proteins lack mammalian post-translational modifications that may be present in native Cyb561d2

  • Structural considerations: Recombinant proteins expressed in prokaryotic systems may have subtle conformational differences

For applications requiring authentic post-translational modifications, researchers should consider mammalian expression systems instead of E. coli-based production .

What are the optimal storage and reconstitution conditions for recombinant mouse Cyb561d2?

Proper handling of recombinant Cyb561d2 is critical for maintaining protein integrity. According to technical specifications:

ParameterRecommended ConditionsNotes
Storage Temperature-20°C to -80°CAliquoting prevents repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Stabilizes protein structure during freeze-thaw
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation before opening is recommended
Long-term StorageAdd glycerol to 5-50% final concentration50% glycerol is standard for optimal stability

It's important to note that repeated freeze-thaw cycles significantly compromise protein activity. For working stocks, store aliquots at 4°C for up to one week rather than repeatedly freezing and thawing samples .

What validated methods exist for detecting and quantifying Cyb561d2 expression in mouse tissues?

Several methodological approaches can be employed for Cyb561d2 detection:

  • Western Blot Analysis: Using anti-Cyb561d2 antibodies with proper controls, this remains the gold standard for protein expression analysis. The His-tagged recombinant protein can serve as a positive control.

  • qRT-PCR: For mRNA expression analysis, gene-specific primers targeting the Cyb561d2 coding region provide quantitative assessment of transcriptional activity.

  • Immunohistochemistry/Immunofluorescence: For tissue localization studies, validated antibodies against mouse Cyb561d2 allow visualization of expression patterns in various tissue compartments.

  • Mass Spectrometry: For detailed protein characterization, LC-MS/MS approaches can identify Cyb561d2 and its potential post-translational modifications.

When comparing expression levels between experimental groups, normalization to appropriate housekeeping genes or proteins is essential for accurate quantification .

How can CRISPR/Cas9 technology be optimized for Cyb561d2 gene knockout studies?

CRISPR/Cas9 approaches offer powerful tools for Cyb561d2 functional studies. When designing knockout experiments:

  • sgRNA Selection: Use a set of three sgRNA targets designed to cleave exonic gDNA regions, which increases the likelihood of generating frameshift mutations leading to functional knockout. Target sequences should be within conserved functional domains of the Cyb561d2 gene.

  • Delivery System Options:

    • All-in-One Lentivectors: Express both Cas9 and sgRNA from a single construct

    • Separate sgRNA vectors: Useful when Cas9 is already stably expressed in the target cells

  • Validation Strategies:

    • Surveyor assay to confirm indel formation

    • Sanger sequencing to characterize the specific mutations

    • Western blot to verify protein depletion

    • Functional assays to confirm phenotypic changes

  • Efficiency Considerations: For optimal results, screen at least 20 isolated clones to identify those with complete gene knockout. Efficiency can be increased by optimizing MOI (up to 10) and infection duration (up to 72 hours) .

What are the key considerations when designing rescue experiments to confirm Cyb561d2 knockout specificity?

Rescue experiments are crucial for validating that phenotypes observed in Cyb561d2 knockout models are specifically due to the absence of this protein. Key considerations include:

  • Expression Vector Design:

    • Use coding sequences resistant to the sgRNAs (through synonymous mutations in the PAM or seed regions)

    • Consider using tissue-specific or inducible promoters to mimic physiological expression patterns

    • Include different tags (FLAG, HA) from those used in knockout validation to distinguish rescued protein

  • Functional Domain Analysis:

    • Design truncated or point-mutated versions of Cyb561d2 to map essential domains

    • Create chimeric proteins with related family members to identify unique functional regions

  • Phenotypic Assessment:

    • Establish clear quantitative parameters for rescue evaluation

    • Analyze dose-dependent effects of the reintroduced protein

    • Compare wildtype and mutant version rescue efficiencies

  • Technical Controls:

    • Empty vector controls to account for delivery method effects

    • Unrelated protein expression to confirm specificity of rescue

How does Cyb561d2 contribute to cellular iron homeostasis and ascorbate recycling?

Cytochrome b561 domain-containing proteins like Cyb561d2 function as transmembrane electron transporters critically involved in:

  • Ascorbate Recycling:

    • Cyb561d2 facilitates electron transfer across membranes to regenerate ascorbate from dehydroascorbate

    • This process maintains intracellular antioxidant capacity

    • The protein's multiple transmembrane domains create a channel for electron movement across the lipid bilayer

  • Iron Homeostasis:

    • Facilitates iron reduction (Fe³⁺ to Fe²⁺) for transport across membranes

    • Contributes to iron storage and mobilization processes

    • Works in concert with other iron-regulatory proteins

  • Redox Signaling:

    • Participates in cellular redox homeostasis

    • May influence redox-sensitive signaling pathways

    • Potentially modulates cellular responses to oxidative stress

Dysregulation of these functions can contribute to pathological conditions, particularly in tissues with high metabolic demands or iron requirements .

What signaling pathways are most significantly affected by Cyb561d2 expression alterations?

Based on functional enrichment analyses, Cyb561d2 and its co-expressed genes influence several key signaling networks:

  • Lipid Biosynthetic Processes:

    • Altered Cyb561d2 expression affects lipid metabolism pathways

    • This may influence membrane composition and microdomain organization

  • Wnt Signaling Pathway:

    • Cyb561d2 shows significant correlation with Wnt pathway components

    • This suggests potential roles in development, cell proliferation and differentiation

  • Hippo Signaling Pathway:

    • Altered expression correlates with changes in the Hippo pathway

    • Implications for tissue growth control and organ size regulation

  • Immune Regulatory Pathways:

    • Positive correlations exist between Cyb561d2 expression and infiltrating levels of:

      • CD4+ T cells

      • Neutrophils

      • Dendritic cells

    • These associations suggest immunomodulatory functions

The precise mechanistic interactions between Cyb561d2 and these pathways require further investigation through pathway-specific inhibition studies combined with Cyb561d2 modulation .

What evidence supports Cyb561d2 as a potential biomarker in disease contexts?

While most research has focused on human CYB561 rather than the mouse ortholog, translational implications from studies indicate:

These findings from human studies provide direction for investigating mouse Cyb561d2 in parallel disease models, particularly in cancer and immune-related pathologies .

How can mouse models of Cyb561d2 function inform therapeutic development?

Mouse models offer valuable systems for exploring Cyb561d2-targeted therapeutic approaches:

  • Knockout Phenotype Analysis:

    • Tissue-specific knockout models can reveal context-dependent functions

    • Comparison between global and conditional knockouts helps distinguish primary from compensatory effects

    • Age-dependent phenotypes may reveal roles in disease progression

  • Drug Target Validation:

    • Small molecule screens targeting Cyb561d2 activity

    • Structure-based drug design for specificity

    • Assessment of pathway-specific modulators affecting Cyb561d2 function

  • Combination Therapy Exploration:

    • Synergistic effects between Cyb561d2 targeting and standard treatments

    • Potential for overcoming treatment resistance

  • Biomarker Development Pipeline:

    • Correlation of Cyb561d2 expression with disease progression

    • Monitoring changes during treatment response

    • Multi-parameter assessment combining Cyb561d2 with other markers

Successful therapeutic approaches in mouse models would provide rationale for exploration in human disease, particularly in contexts where CYB561 dysregulation has been documented .

What are common technical challenges in working with recombinant Cyb561d2 and how can they be addressed?

Researchers frequently encounter several challenges when working with Cyb561d2:

ChallengeSolution ApproachTechnical Details
Poor Protein SolubilityBuffer OptimizationInclude 6% trehalose and maintain pH at 8.0; consider detergent addition for membrane protein stability
Degradation During StorageStorage Protocol RefinementAliquot with 50% glycerol and store at -80°C; avoid repeated freeze-thaw cycles
Low Expression YieldExpression System AdjustmentOptimize codon usage for E. coli; consider alternative expression systems for higher yields
Antibody Cross-ReactivityValidation ControlsUse recombinant protein as positive control; include knockout samples as negative controls
Functional Assay LimitationsActivity Measurement StandardizationDevelop standardized electron transfer assays specific to Cyb561d2 function

When experimental issues persist, consider consulting literature on related cytochrome b561 family members, as techniques may be adaptable across this protein family .

How can reproducibility be ensured in Cyb561d2 functional studies?

Ensuring reproducible results in Cyb561d2 research requires attention to several methodological aspects:

  • Protein Quality Control:

    • Verify protein purity (>90% by SDS-PAGE)

    • Confirm identity through mass spectrometry

    • Assess batch-to-batch consistency with functional assays

  • Experimental Design Considerations:

    • Include appropriate positive and negative controls

    • Use multiple cell lines or tissue types to validate observations

    • Perform technical and biological replicates (minimum n=3)

  • Data Analysis Standardization:

    • Pre-register analysis methods before conducting experiments

    • Apply consistent normalization techniques

    • Use appropriate statistical methods for data type

  • Reporting Standards:

    • Document detailed methods including catalog numbers

    • Record all buffer compositions precisely

    • Share raw data and analysis scripts when possible

Following these practices significantly improves the reliability and reproducibility of Cyb561d2 research findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.