Recombinant Mouse Cytochrome b561 (Cyb561)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Cytochrome b561 (Cyb561)

Recombinant Mouse Cytochrome b561 (Cyb561) is a transmembrane electron transport protein engineered for expression in heterologous systems, such as E. coli. It belongs to the cytochrome b561 family, characterized by six transmembrane α-helices and two non-covalently bound heme-b groups coordinated by four conserved histidine residues . The protein facilitates transmembrane electron transfer (TMET) and ascorbate (ASC) recycling, playing critical roles in iron metabolism, neuroendocrine function, and tumor biology .

Functional Mechanism

Cyb561 catalyzes the reduction of MDA to ASC using electrons from ASC on the cytosolic side, thereby regenerating ASC for metabolic processes. This activity supports dopamine synthesis in neuroendocrine cells and iron transport across membranes . Spectroscopic studies of homologs (e.g., Mm_CYB561D1) reveal:

  • Redox Potentials: Midpoint potentials (~–100 mV to +100 mV) for heme centers, enabling ASC-driven electron transfer .

  • Electron Transfer Pathway: Sequential reduction/oxidation of hemes, with no direct electronic coupling between them .

Key Research Insights

Study FocusFindingsSource
Spectral PropertiesAbsorption peaks at ~561 nm; HALS (highly asymmetric low-spin) heme configuration
Tumor SuppressionHomologs like Hs_CYB561D2 (101F6) inhibit lung cancer growth via ASC-mediated pathways
ELISA-Based QuantificationDetection range: 62.5–4000 pg/mL; sensitivity: 31.29 pg/mL

Tumor Biology

Cyb561 homologs exhibit dual roles:

  • Promotion: CYB561 upregulation in breast cancer correlates with poor prognosis .

  • Suppression: 101F6 (Mm_CYB561D2 ortholog) inhibits glioma invasion and breast/bladder cancer growth .

Mouse Cyb561 Recombinant Protein

ParameterDetailsSource
UniProt IDQ60720
Molecular Weight27,822 Da
Subcellular LocationSecretory vesicle membrane (chromaffin granules, lysosomes)
FunctionFerric-chelate reductase; transmembrane electron transfer carrier

ELISA Kit for Cyb561 Detection

ComponentDetailsSource
TargetMouse Cyb561 (natural and recombinant forms)
Assay TypeSandwich ELISA
Detection Range62.5–4000 pg/mL
Sample CompatibilitySerum, plasma, tissue homogenates, cell culture supernatants

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cyb561; Mcyt; Transmembrane ascorbate-dependent reductase CYB561; Chromaffin granule Cyt b561; CGCytb; Cytochrome b-561; Cytochrome b561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cyb561
Target Protein Sequence
MEHSSASVPAALPYYVAFSQLLGLTVVAVTGAWLGLYRGGIAWESSLQFNVHPLCMVIGM IFLQGDALLVYRVFRREAKRTTKILHGLLHVFAFIIALVGLVAVFDYHKKKGYADLYSLH SWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLFSVGTALLGLKE ALLFKLGSKYSTFEPEGVLANVLGLLLVCFGVVVLYILAQADWKRPSQAEEQALSMDFKT LTEGDSPSPQ
Uniprot No.

Target Background

Function
Recombinant Mouse Cytochrome b561 (Cyb561) is a transmembrane reductase. It utilizes cytoplasmic ascorbate as an electron donor, transferring electrons across membranes to reduce monodehydro-L-ascorbate radical within the lumen of secretory vesicles. This function is crucial for the regeneration and homeostasis of ascorbate within secretory vesicles, providing the reducing equivalents necessary to support intravesicular enzyme activity.
Gene References Into Functions
  1. Dihydrolipoic acid (DHLA)-dependent reduction of two Cyt-b561 proteins. PMID: 22526465
  2. Cytochrome b561 expression is androgen-regulated in prostate cancer (CaP) cells. Increased expression in castration-recurrent prostate cancer reflects amplified androgen receptor signaling in tumor cells. PMID: 21045261
  3. Four members of the b561 family of predicted ferric reductases (mouse cytochrome b561, human duodenal cytochrome b, and mouse stromal cell-derived receptor 2) exhibit ferric reductase activity. PMID: 14499595
Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Multi-pass membrane protein.
Tissue Specificity
Abundantly distributed in a number of neuroendocrine tissues.

Q&A

What is the basic structure of mouse Cytochrome b561?

Mouse Cytochrome b561 (CYB561) is an integral membrane protein with six transmembrane domains and two heme-b redox centers, one positioned on each side of the host membrane. The protein forms a homodimer, with each protomer containing the six transmembrane helices and two heme groups. The heme-b chromophores are coordinated by four highly conserved histidine residues localized in the central four transmembrane helices . This structural arrangement is critical for the protein's function in facilitating electron transfer across membranes. X-ray crystallography studies have revealed that the transmembrane helices are arranged to create a pathway for electron movement between the two heme centers .

What are the primary functional characteristics of mouse CYB561?

The primary functional characteristics of mouse CYB561 are:

  • Ascorbate reducibility: CYB561 can be reduced by ascorbate (vitamin C), which serves as an electron donor .

  • Transmembrane electron transfer: The protein facilitates electron transport across biological membranes via its two heme centers .

  • No bioenergetic role: Unlike some other cytochromes, CYB561 proteins are localized in membranes not involved in bioenergization pathways .

These properties enable CYB561 to participate in various physiological processes, including ascorbate recycling and iron absorption. The transmembrane electron transfer capability depends on the sequential reduction and oxidation of the high-potential (HP) and low-potential (LP) hemes .

How are CYB561 proteins classified and distributed across species?

CYB561 proteins have been classified into seven distinct groups based on primary structural similarities. Five of these groups contain CYB561s with only the core six transmembrane domains . These proteins can be found in a wide range of animal and plant phyla, occurring in various organs and cell types . Within mammals, multiple homologs exist, such as Mm_CYB561D1 and Mm_CYB561D2 in mice, and Hs_CYB561D1 and Hs_CYB561D2 in humans .

The evolutionary conservation of CYB561 across eukaryotes underscores its biological importance. The proteins are notably absent in prokaryotes, suggesting they evolved specifically to meet the needs of eukaryotic cellular organization and metabolism .

What are the characterized mouse CYB561 homologs and their differences?

In mice, several CYB561 homologs have been identified, with Mm_CYB561D1 and Mm_CYB561D2 being the most studied. These homologs differ in their tissue distribution, subcellular localization, and potentially their specific functions:

HomologNotable CharacteristicsResearch Status
Mm_CYB561D1Shows HALS (highly asymmetric low-spin) character in both hemes; no spectral differences between the two hemes; comparable binding constants for ascorbate sites and midpoint reduction potentials to other CYB561 family members Recently characterized for optical, redox, and structural properties
Mm_CYB561D2Ortholog of human tumor suppressor 101F6 (Hs_CYB561D2); potential role in cancer pathologyHas been studied in detail

Unlike some other CYB561 proteins that show distinct spectral differences between their two heme centers, Mm_CYB561D1 does not exhibit such differences, suggesting potential functional divergence among homologs .

What expression systems are most effective for producing recombinant mouse CYB561?

For recombinant production of mouse CYB561, Saccharomyces cerevisiae has proven to be an effective expression system. This yeast-based approach offers several advantages for membrane protein production:

  • Eukaryotic processing: Yeast provides appropriate post-translational modifications and membrane insertion machinery for mammalian membrane proteins.

  • Background considerations: Yeast membranes contain minimal ascorbate-reducible cytochromes, reducing interference in spectroscopic analyses .

  • Purification compatibility: His₆-tagged recombinant CYB561 can be effectively purified from yeast membranes using affinity chromatography .

During expression, it's essential to monitor the A280/A414 ratio, which should exceed 1.1 in purified samples to ensure minimal contamination with other heme proteins. The expression in yeast allows researchers to obtain sufficient quantities of functional protein for subsequent biochemical and biophysical characterization .

What spectroscopic methods are most informative for characterizing CYB561 proteins?

Several complementary spectroscopic techniques provide valuable insights into CYB561 structure, function, and redox properties:

  • Circular Dichroism (CD) Spectroscopy: Useful for examining potential electronic interactions between the two heme-b chromophores in both oxidized and reduced states. For Mm_CYB561D1, CD spectroscopy revealed no significant exciton splitting, indicating limited electronic interaction between the hemes .

  • Electron Paramagnetic Resonance (EPR): Critical for characterizing the spin state and coordination environment of heme centers. EPR analysis of Mm_CYB561D1 demonstrated that both hemes exhibit highly asymmetric low-spin (HALS) character, with minimal signals at g₂ = 3.16, which is typically associated with rhombic heme environments in other CYB561 proteins .

  • UV-Visible Absorption Spectroscopy: Essential for monitoring reduction states and for redox titration experiments. This method can detect spectral differences between the two heme centers that exist in some CYB561 proteins .

  • X-ray Crystallography: Provides high-resolution structural information, including the arrangement of transmembrane helices and the positioning of heme groups. This technique has been successfully applied to elucidate the structure of CYB561 from plants, revealing important insights into the mechanism of ascorbate-dependent electron transfer .

How can researchers effectively perform redox titration experiments on CYB561?

Redox titration experiments are crucial for determining the midpoint potentials of the heme centers in CYB561 proteins. An effective protocol includes:

The interpretation of redox titration data should consider the possibility of cooperative effects between the two heme centers, which may influence the apparent midpoint potentials and the shape of the titration curves.

How do mutations in conserved histidine residues affect CYB561 function?

Targeted mutations in the highly conserved heme-coordinating histidine residues provide critical insights into CYB561 structure-function relationships:

  • LP-heme (intra-vesicular side) coordination mutations: Mutations in histidine residues coordinating the low-potential heme of Arabidopsis TCytb/CYB561B1 and mouse CGCytb/CYB561A1 resulted in nearly undetectable protein levels, suggesting these residues are essential for protein stability and proper folding .

  • HP-heme (cytosolic side) coordination mutations: In contrast, mutations in histidine residues coordinating the high-potential heme minimally affected protein expression but significantly altered ascorbate-reduction kinetics and reduced heme content. This indicates these residues are more important for function than for structural integrity .

  • EPR studies of mutants: Detailed EPR analysis of Arabidopsis TCytb/CYB561B1 mutant proteins revealed that the HP-heme center is located on the cytosolic side of the protein, contradicting earlier models .

What is known about the ascorbate binding sites in CYB561 proteins?

CYB561 proteins contain two putative ascorbate binding sites that are critical for their function as ascorbate-dependent oxidoreductases:

  • Binding constants: Studies of Mm_CYB561D1 have shown that the binding constants of its two putative ascorbate binding sites are comparable to those of other members of the CYB561 protein family .

  • Conserved residues: Mutagenesis studies of conserved residues, such as K83 in maize CYB561B1, have demonstrated their importance for ascorbate binding. Mutations at this position resulted in altered midpoint redox potentials and ascorbate-reduction kinetics .

  • Structural basis: Crystal structures of CYB561 in both ascorbate-free and ascorbate-bound states have provided molecular details of how these proteins interact with their substrate. The binding sites involve specific amino acid residues that create a suitable microenvironment for ascorbate docking and electron transfer .

  • Asymmetric roles: The ascorbate binding sites on opposite sides of the membrane may have distinct functional roles, with one primarily involved in accepting electrons and the other in donating them, facilitating directional electron transfer across the membrane .

What is the mechanism of transmembrane electron transfer in CYB561?

The transmembrane electron transfer (TMET) mechanism in CYB561 proteins involves several key steps:

  • Electron donation: Ascorbate binds to a specific site on the cytosolic side of the protein and donates an electron to the high-potential (HP) heme .

  • Inter-heme electron transfer: The electron transfers from the HP-heme to the low-potential (LP) heme on the opposite side of the membrane. This process is facilitated by the appropriate positioning of the two heme groups within the transmembrane domain structure .

  • Electron donation to acceptor: The electron is then donated from the LP-heme to an acceptor molecule (such as ferric iron or a monodehydroascorbate radical) on the intra-vesicular side .

  • Loop regions: Mutations in loop regions on the intra-vesicular side severely decreased transmembrane Fe³⁺-reductase activity in LCytb/CYB561A3, while mutations on the cytoplasmic side had comparatively less effect. This supports the model of directional electron flow from the cytoplasmic to the intra-vesicular side .

Homology modeling of Mm_CYB561D1, combined with spectroscopic data, has provided insights into the likely transmembrane electron transfer pathways. The absence of electronic interaction between the two heme centers, as demonstrated by CD spectroscopy, suggests that the electron transfer may proceed through a protein-mediated pathway rather than direct heme-to-heme interaction .

What is the relationship between CYB561 proteins and cancer pathology?

Two homologous CYB561 proteins in both humans and rodents have been implicated in cancer pathology:

  • Tumor suppressor function: The human tumor suppressor 101F6 protein (Hs_CYB561D2) and its mouse ortholog (Mm_CYB561D2) appear to play roles in cancer pathogenesis, though the exact mechanisms remain to be fully elucidated .

  • Gene expression analysis: Studies of gene expression profiles in cancer tissues have identified CYB561 among genes whose expression may be deregulated in certain cancers. For instance, in ovarian cancer tissues, CYB561 has been identified among differentially expressed genes with potential utility as a biomarker .

  • Research potential: The connection between CYB561 proteins and cancer opens opportunities for developing targeted therapies or diagnostic tools. Understanding the specific role of these proteins in cancer metabolism or signaling pathways could lead to novel treatment approaches.

Further research is needed to clarify whether the cancer-related functions of these proteins are connected to their ascorbate-dependent electron transfer activities or involve other mechanisms. Investigating the potential links between vitamin C metabolism, iron homeostasis, and cancer progression in relation to CYB561 function represents an important frontier in this field.

How do the spectral and redox properties of mouse CYB561D1 compare to other CYB561 family members?

Comparative analysis of spectral and redox properties reveals both similarities and differences between Mm_CYB561D1 and other CYB561 family members:

PropertyMm_CYB561D1Other CYB561 ProteinsSignificance
Spectral differences between hemesNo discernible differencesSeveral CYB561 proteins show distinct spectral signatures for the two hemesSuggests potential functional divergence of Mm_CYB561D1
Exciton couplingMinimal to noneVariable among family membersIndicates limited electronic interaction between hemes in Mm_CYB561D1
EPR characteristicsBoth hemes show HALS characterSome members show rhombic heme environments (g₂ = 3.16)Points to unique coordination environment in Mm_CYB561D1
Midpoint reduction potentialsComparable to other family membersVariable depending on specific isoform and organismSuggests conserved electron transfer capabilities despite structural differences
Ascorbate binding constantsSimilar to other CYB561 proteinsRelatively conserved across the familyIndicates preserved ascorbate-dependent function

These comparative data highlight the evolutionary adaptations of different CYB561 isoforms while maintaining core functional properties. The unique spectral properties of Mm_CYB561D1, particularly the lack of spectral distinction between its two hemes, suggest it may have evolved specialized functions compared to other family members .

What are the challenges in structural determination of mammalian CYB561 proteins?

Structural determination of mammalian CYB561 proteins presents several challenges:

  • Membrane protein crystallization: As integral membrane proteins, CYB561s are difficult to crystallize due to their hydrophobicity and the need for detergents or lipid environments that can interfere with crystal formation.

  • Heterologous expression: Obtaining sufficient quantities of properly folded mammalian membrane proteins often requires optimization of expression systems, with yeast being a preferred option for CYB561 proteins .

  • Protein stability: The presence of two heme groups can affect protein stability during purification and crystallization attempts. Mutations in heme-coordinating histidines, particularly those for the LP-heme, often result in nearly undetectable protein levels, highlighting their importance for structural integrity .

  • Post-translational modifications: Potential mammalian-specific modifications may not be properly reproduced in heterologous expression systems, affecting protein function or crystallization properties.

  • Conformational flexibility: The dynamic nature of electron transfer proteins can result in conformational heterogeneity that complicates structural studies.

Researchers have overcome some of these challenges using homology modeling based on related proteins with known structures . The successful crystallization of plant CYB561 provides a valuable template for understanding mammalian homologs, but direct structural determination of mammalian CYB561s remains an important goal for future research.

What alternative electron donors besides ascorbate might function with CYB561 proteins?

While ascorbate is the primary physiological electron donor for CYB561 proteins, research has identified several alternative electron donors:

  • Dithiothreitol (DTT) and dithioerythritol: These thiol-based reducing agents can reduce Arabidopsis TCytb/CYB561B and mouse TSCytb/CYB561E. This suggests CYB561 proteins may be able to accept electrons from various reducing agents with appropriate redox potentials .

  • Potential physiological alternatives: Investigation of lipoyl-domain-containing proteins as potential CYB561 redox partners has been suggested, which could reveal alternative electron transfer pathways in tissues or cellular compartments where ascorbate availability is limited .

  • Artificial electron donors: In experimental settings, various artificial electron donors have been used to characterize CYB561 redox properties, including sodium dithionite for complete reduction in spectroscopic studies .

The ability of CYB561 proteins to accept electrons from alternative donors may have physiological significance under conditions of oxidative stress or in specific subcellular compartments. This flexibility could contribute to the diverse functions of CYB561 proteins across different tissues and organisms.

What are the most promising approaches for investigating CYB561 function in vivo?

Future research on CYB561 function in vivo could benefit from several promising approaches:

  • CRISPR/Cas9 gene editing: Generation of knockout or knock-in mouse models for specific CYB561 isoforms would allow detailed investigation of their physiological roles in different tissues.

  • Tissue-specific conditional expression: Using Cre-lox systems for tissue-specific and inducible expression or deletion of CYB561 genes could help elucidate their functions in particular cell types without systemic effects.

  • In vivo imaging: Development of fluorescent or bioluminescent reporters of CYB561 activity could enable real-time monitoring of their function in living cells or tissues.

  • Metabolomics and transcriptomics: Comprehensive analysis of metabolic changes and gene expression profiles in tissues with modified CYB561 expression could reveal downstream pathways affected by these proteins.

  • Interactome analysis: Identification of protein interaction networks for different CYB561 isoforms in various tissues could uncover unknown functional connections and regulatory mechanisms.

These approaches, particularly when combined, have the potential to significantly advance our understanding of CYB561 biology beyond what can be learned from in vitro studies alone.

How might research on CYB561 contribute to understanding vitamin C metabolism disorders?

Research on CYB561 proteins has significant potential to enhance our understanding of vitamin C metabolism disorders:

  • Ascorbate recycling: As key players in ascorbate recycling, CYB561 proteins might be involved in conditions characterized by vitamin C deficiency despite adequate intake, suggesting defects in vitamin C utilization or recycling pathways.

  • Iron metabolism connection: The role of some CYB561 proteins in iron absorption connects them to disorders involving iron homeostasis, which often intersect with vitamin C metabolism due to ascorbate's role in enhancing iron absorption.

  • Oxidative stress conditions: CYB561's role in maintaining reduced ascorbate pools may be particularly relevant in conditions characterized by increased oxidative stress, where ascorbate recycling becomes crucial for cellular antioxidant defense.

  • Genetic variation: Investigating genetic variants of CYB561 genes in populations with different susceptibilities to scurvy or other vitamin C-related disorders could reveal previously unknown factors affecting vitamin C requirements.

  • Therapeutic potential: Understanding CYB561 function could lead to strategies for enhancing vitamin C efficacy in conditions where supplementation alone is insufficient, potentially through modulating CYB561 activity or expression.

This research direction could have particular relevance for conditions such as scurvy, iron-deficiency anemia, and various neurodegenerative diseases where oxidative stress and vitamin C metabolism play important roles.

What computational approaches are most valuable for predicting CYB561 structure-function relationships?

Several computational approaches have proven valuable for predicting structure-function relationships in CYB561 proteins:

  • Homology modeling: Given the successful crystallization of some CYB561 proteins, homology modeling has become a powerful tool for predicting the structures of uncharacterized CYB561 proteins. This approach has been successfully applied to Mm_CYB561D1 to predict its 3D structure and potential electron transfer pathways .

  • Molecular dynamics simulations: These simulations can provide insights into the dynamic behavior of CYB561 proteins within membranes, including conformational changes that might occur during electron transfer.

  • Quantum mechanical/molecular mechanical (QM/MM) calculations: For detailed modeling of electron transfer processes, QM/MM approaches can simulate the electronic structures of the heme groups and their interactions with surrounding protein environments.

  • Evolutionary coupling analysis: This method can identify co-evolving residues that are likely to be structurally or functionally coupled, providing clues about important interaction networks within the protein.

  • Docking simulations: To understand substrate interactions, particularly with ascorbate, docking simulations can predict binding modes and energetics, guiding experimental studies of substrate specificity.

Integration of these computational approaches with experimental validation represents a powerful strategy for advancing our understanding of CYB561 structure-function relationships, particularly for isoforms that have proven challenging to characterize experimentally.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.