Recombinant Mouse Cytochrome b5 (Cyb5a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Cytochrome b5 (Cyb5a)

Recombinant Mouse Cytochrome b5 (Cyb5a) is a genetically engineered version of the mouse cytochrome b5 protein, which is a membrane-bound hemoprotein. This protein plays a crucial role as an electron carrier in various enzymatic reactions, particularly in the metabolism of steroids and drugs. The recombinant form is produced through genetic engineering techniques, allowing for its expression in host organisms such as bacteria or yeast. This approach enables the large-scale production of the protein for research and potential therapeutic applications.

Function and Role of Cytochrome b5

Cytochrome b5 is involved in several biological processes, including the reduction of methemoglobin to hemoglobin and the facilitation of electron transfer reactions in steroid synthesis. In the context of steroidogenesis, cytochrome b5 is essential for the activity of certain cytochrome P450 enzymes, which are critical for converting cholesterol into various steroids. The protein's role in electron transfer enhances the efficiency of these enzymatic reactions.

Research Findings on Recombinant Mouse Cytochrome b5

Research on recombinant mouse cytochrome b5 has focused on its role in steroid synthesis and drug metabolism. For instance, studies using knockout mice have shown that the absence of cytochrome b5 in Leydig cells leads to impaired 17,20-lyase activity, a crucial step in the synthesis of certain steroids . This highlights the importance of cytochrome b5 in maintaining normal steroidogenic pathways.

Applications of Recombinant Mouse Cytochrome b5

The recombinant form of mouse cytochrome b5 can be used in various applications, including:

  • Biological Research: To study the mechanisms of steroid synthesis and drug metabolism in a controlled manner.

  • Therapeutic Development: As a potential component in therapies targeting steroid-related disorders or drug metabolism pathways.

  • Biotechnology: For the production of enzymes involved in biotechnological processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Cyb5a; Cyb5; Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-134
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Cyb5a
Target Protein Sequence
AGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISAL AVALMYRLYMAED
Uniprot No.

Target Background

Function
Cytochrome b5 is a membrane-bound hemoprotein that functions as an electron carrier for various membrane-bound oxygenases. It also plays a role in several steps of the sterol biosynthesis pathway, notably in the introduction of the C-5 double bond during C-5 desaturation.
Gene References Into Functions
  1. Demonstration of the physiological importance of cytochrome b5 in activating the 17,20-lyase reaction and the production of 19-carbon sex steroids from 21-carbon precursors in mice. PMID: 26974035
  2. Cytochrome b5 and cytokeratin 17 serve as biomarkers in bronchoalveolar fluid, indicating the onset of acute lung injury. PMID: 22792238
Database Links
Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

Basic Research Questions

  • What is mouse Cytochrome b5 (Cyb5a) and what expression systems are used for recombinant production?

    Cytochrome b5 (Cyb5a) is a small heme-containing protein (approximately 15-16 kDa) that functions as an electron carrier for various membrane-bound oxygenases and plays critical roles in lipid metabolism, steroid biosynthesis, and cytochrome P450-mediated reactions .

    For recombinant production, multiple expression systems have proven effective:

    Expression SystemAdvantagesApplications
    E. coliHigh yield, cost-effective, straightforward purificationStructural studies, enzymatic assays
    Saccharomyces cerevisiaePost-translational modifications, membrane integrationFunctional studies, protein-protein interactions
    BaculovirusHigher eukaryotic processing, high expressionComplex structural analysis
    Mammalian cellsNative folding and modificationsIn-cell studies, physiological relevance

    Methodologically, His-tagged recombinant mouse Cyb5a (typically containing amino acids 2-134) can be efficiently expressed in E. coli with >90% purity achievable using nickel affinity chromatography . For functional studies requiring membrane association, yeast expression systems provide advantages as demonstrated in multiple studies of cytochrome b5-dependent electron transfer pathways .

  • How does the tissue distribution of mouse Cyb5a compare to its human ortholog?

    Mouse Cyb5a exhibits widespread tissue distribution with particularly high expression in the liver, where it participates extensively in drug metabolism pathways. Quantitative tissue expression analysis reveals:

    Research has shown that mouse Cyb5a is most abundant in thymus, spleen, colon, and large intestine according to NCBI gene expression data . In comparison, human CYB5A is detected in a broad range of tissues according to protein atlas data .

    Methodologically, tissue expression can be quantified using:

    • Quantitative RT-PCR for mRNA levels (shows approximately 12-fold individual variation)

    • Western blotting with specific anti-Cyb5a antibodies for protein levels (shows approximately 19-fold variation)

    • Immunohistochemistry for cellular and subcellular localization

    Gender and environmental factors (including smoking) influence Cyb5a content in both species, creating significant biological variability that researchers should account for in experimental design .

  • What are the spectral characteristics of recombinant mouse Cyb5a and how are they measured?

    Recombinant mouse Cyb5a exhibits characteristic spectral properties that serve as important quality control parameters and functional indicators:

    Spectral FeatureOxidized FormReduced FormMeasurement Technique
    Soret band413 nm425 nmUV-visible spectroscopy
    α-bandAbsent557 nmUV-visible spectroscopy
    β-bandWeak527 nmUV-visible spectroscopy
    Heme content--Difference spectroscopy between oxidized/reduced forms

    Methodologically, the heme content (crucial for functional studies) is determined by recording the difference spectrum between oxidized and NADH-reduced protein, using a differential molar extinction coefficient of ε(429–411 nm) = 222 mM⁻¹cm⁻¹ . This spectroscopic characterization is essential for confirming proper folding and heme incorporation in recombinant preparations.

  • What purification strategies are most effective for obtaining high-quality recombinant mouse Cyb5a?

    Purification of recombinant mouse Cyb5a typically follows a multi-step process:

    1. Expression optimization: Induction conditions significantly impact yield and quality

      • IPTG concentration: Typically 0.5-1.0 mM

      • Induction temperature: 25-30°C often provides better folding than 37°C

      • Induction time: 4-16 hours depending on expression system

    2. Lysis conditions: Buffer composition critical for maintaining stability

      • Phosphate buffer (50 mM, pH 7.0-7.4)

      • Addition of protease inhibitors

      • Mild detergents for membrane-bound forms

    3. Affinity chromatography: His-tagged variants purified using:

      • Ni Sepharose High Performance resin

      • Imidazole concentration for elution: 300 mM optimal

      • Addition of glycerol (10% w/v) in storage buffer to maintain stability

    4. Quality assessment:

      • SDS-PAGE showing >90% purity

      • Spectroscopic confirmation of heme incorporation

      • Activity assays measuring electron transfer capability

    Maintaining the heme cofactor during purification is essential for functional studies, and all buffers should contain reducing agents like DTT (1 mM) to prevent oxidative damage .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.